PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo10G0009900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 217aa MW: 24874.2 Da PI: 10.187 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63 | 5.9e-20 | 37 | 83 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +grWT+eEd +l +av+++ g++Wk+Ia+++ Rt+ qc +rwqk+l Spipo10G0009900 37 KGRWTPEEDAILFRAVQRHKGRNWKKIAECFK-DRTDVQCLHRWQKVL 83 79*****************************9.************986 PP | |||||||
2 | Myb_DNA-binding | 63.8 | 3.3e-20 | 89 | 135 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd+++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l Spipo10G0009900 89 KGPWSKEEDDIIIQMVNKHGPKKWSTIAQALP-GRIGKQCRERWHNHL 135 79******************************.*************97 PP | |||||||
3 | Myb_DNA-binding | 51 | 3.2e-16 | 141 | 183 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 + +WT+eE++ l++a++ +G++ W+ + ++ gRt++ +k++w+ Spipo10G0009900 141 KEAWTQEEELALIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 183 579*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.963 | 32 | 83 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.24E-20 | 35 | 98 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-16 | 36 | 85 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-17 | 37 | 83 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-24 | 38 | 99 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.00E-13 | 39 | 83 | No hit | No description |
PROSITE profile | PS51294 | 31.666 | 84 | 139 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.5E-32 | 86 | 182 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-18 | 88 | 137 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.27E-15 | 91 | 135 | No hit | No description |
Pfam | PF13921 | 7.5E-19 | 92 | 150 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.5E-27 | 100 | 143 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.8E-14 | 140 | 188 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.075 | 140 | 190 | IPR017930 | Myb domain |
CDD | cd00167 | 1.66E-10 | 143 | 183 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-21 | 144 | 190 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003713 | Molecular Function | transcription coactivator activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
GGGEEATTAL HEENSSHFQE QRPMHGRISG PTRRSTKGRW TPEEDAILFR AVQRHKGRNW 60 KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDDII IQMVNKHGPK KWSTIAQALP 120 GRIGKQCRER WHNHLNPAIS KEAWTQEEEL ALIHAHQIYG NKWAELTKFL PGRTDNAIKN 180 HWNSSVKKKL DSYLASGLLS QFQGLPHVES SNLTVK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 2e-68 | 37 | 190 | 6 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 2e-68 | 37 | 190 | 6 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Transcription activator involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:26069325}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00466 | DAP | Transfer from AT4G32730 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constant levels during cell cycle. Activated by CYCB1. {ECO:0000269|PubMed:17287251}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008795071.1 | 1e-125 | transcription factor MYB3R-1-like isoform X1 | ||||
Refseq | XP_008795072.1 | 1e-125 | transcription factor MYB3R-1-like isoform X2 | ||||
Swissprot | Q9S7G7 | 1e-107 | MB3R1_ARATH; Transcription factor MYB3R-1 | ||||
TrEMBL | A0A1D1YIG5 | 1e-133 | A0A1D1YIG5_9ARAE; Myb-related protein 3R-1 | ||||
STRING | XP_008795071.1 | 1e-124 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2495 | 38 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G32730.1 | 1e-110 | Homeodomain-like protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo10G0009900 |
Publications ? help Back to Top | |||
---|---|---|---|
|