PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0178500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 140aa    MW: 16365.3 Da    PI: 10.384
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0178500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.93.6e-08811162055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yp+ +++  L +++gL+++q+ +WF N+R ++
  Spipo0G0178500  81 YKWPYPTDADKVALVESTGLNQKQINNWFINQRKRR 116
                     4679***************************99764 PP

2ELK35.32.4e-123657122
             ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                    EL+++Llr YsgyL+sLkq Fs
  Spipo0G0178500 36 ELRDELLRRYSGYLSSLKQDFS 57
                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5121310.513656IPR005539ELK domain
SMARTSM011881.8E-63657IPR005539ELK domain
PfamPF037894.8E-103657IPR005539ELK domain
PROSITE profilePS5007112.0556119IPR001356Homeobox domain
SuperFamilySSF466898.98E-1957133IPR009057Homeodomain-like
SMARTSM003891.3E-1158123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.3E-2761120IPR009057Homeodomain-like
CDDcd000863.36E-1064120No hitNo description
PfamPF059205.4E-1776115IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
RERERREAEA ARSSVEESGG REVGTRGSAA RKEERELRDE LLRRYSGYLS SLKQDFSKKK  60
KKGNLPKEAR QTLLDWWNLH YKWPYPTDAD KVALVESTGL NQKQINNWFI NQRKRRWKPS  120
ESMQFAVLDS LSSPFYLDG*
Functional Description ? help Back to Top
Source Description
UniProtMay play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269|PubMed:11934861, ECO:0000269|PubMed:12900451, ECO:0000269|PubMed:7866029}.
UniProtPlays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).
UniProtINDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006841054.15e-59homeobox protein knotted-1-like 2 isoform X2
SwissprotP466392e-46KNAT1_ARATH; Homeobox protein knotted-1-like 1
SwissprotQ84JS61e-46KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A1D1XP503e-58A0A1D1XP50_9ARAE; Homeobox protein knotted-1-like 6 (Fragment)
TrEMBLW1P5151e-57W1P515_AMBTC; Uncharacterized protein
STRINGERN027292e-58(Amborella trichopoda)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3229724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-38KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. dela Paz JS, et al.
    Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events.
    PLoS Genet., 2012. 8(12): p. e1003136
    [PMID:23284301]
  3. Liu C, et al.
    Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis.
    J Integr Plant Biol, 2013. 55(8): p. 682-95
    [PMID:23931744]
  4. Liu B, et al.
    NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana.
    J. Exp. Bot., 2013. 64(17): p. 5345-57
    [PMID:23963677]
  5. Simonini S,Kater MM
    Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance.
    J. Exp. Bot., 2014. 65(6): p. 1455-65
    [PMID:24482368]
  6. Scofield S,Dewitte W,Murray JA
    STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1.
    Plant Signal Behav, 2018.
    [PMID:24776954]
  7. Lee JE,Lampugnani ER,Bacic A,Golz JF
    SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis.
    Plant J., 2014. 80(1): p. 122-35
    [PMID:25060324]
  8. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  9. Rast-Somssich MI, et al.
    Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta.
    Genes Dev., 2015. 29(22): p. 2391-404
    [PMID:26588991]
  10. Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B
    Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering.
    Gene, 2016. 587(2): p. 120-31
    [PMID:27154816]
  11. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  12. Lozano-Sotomayor P, et al.
    Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.
    Plant J., 2016. 88(3): p. 437-451
    [PMID:27402171]
  13. Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA
    Nonreciprocal complementation of KNOX gene function in land plants.
    New Phytol., 2017. 216(2): p. 591-604
    [PMID:27886385]
  14. Woerlen N, et al.
    Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root.
    Planta, 2017. 245(6): p. 1079-1090
    [PMID:28204875]
  15. Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD
    A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels.
    PLoS ONE, 2017. 12(5): p. e0177045
    [PMID:28493925]
  16. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  17. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]
  18. Felipo-Benavent A, et al.
    Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
    Development, 2019.
    [PMID:30389856]