![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo0G0160400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 184aa MW: 20577.4 Da PI: 9.3888 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.3 | 3.5e-18 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l++ v+ +G g+W+++++ g+ R++k+c++rw +yl Spipo0G0160400 17 KGLWSPEEDEKLLRHVTTYGHGCWSSVPKLAGLQRCGKSCRLRWMNYL 64 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.4 | 2.1e-15 | 70 | 112 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 rg++++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w+ Spipo0G0160400 70 RGAFSPEEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWN 112 89********************.*********.*********998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-26 | 9 | 67 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.521 | 12 | 64 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.31E-30 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.5E-13 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-16 | 17 | 64 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.62E-12 | 20 | 64 | No hit | No description |
PROSITE profile | PS51294 | 25.126 | 65 | 119 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-26 | 68 | 119 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.1E-13 | 69 | 117 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-14 | 70 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.09E-10 | 72 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
RCLMGRHSCC FKQKLRKGLW SPEEDEKLLR HVTTYGHGCW SSVPKLAGLQ RCGKSCRLRW 60 MNYLRPDLKR GAFSPEEENL IIELHAVLGN RWSQIAAQLP GRTDNEIKNL WNSSIKKQLR 120 QRGIDPTTHR PLSEVNAGVD KTAASDELVN PIPSPPSGNS KELFLDQSSS SSCRSPVDYG 180 GGGH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-30 | 15 | 119 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018481404.1 | 3e-91 | PREDICTED: transcription repressor MYB6-like | ||||
Swissprot | Q8VZQ2 | 1e-88 | MYB61_ARATH; Transcription factor MYB61 | ||||
TrEMBL | A0A218X450 | 5e-88 | A0A218X450_PUNGR; Uncharacterized protein | ||||
TrEMBL | Q0PJD4 | 4e-88 | Q0PJD4_SOYBN; MYB transcription factor MYB64 (Fragment) | ||||
STRING | XP_010490115.1 | 4e-88 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2310 | 37 | 94 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09540.1 | 6e-91 | myb domain protein 61 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo0G0160400 |
Publications ? help Back to Top | |||
---|---|---|---|
|