PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo0G0120600 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 155aa MW: 17978.8 Da PI: 10.1294 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 84.2 | 7.9e-27 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n++ rqvtfskRr ++KKAeEL +LCdaev +i+fsstg+lyeyss Spipo0G0120600 10 KIDNTTTRQVTFSKRRRSLFKKAEELAILCDAEVGLIVFSSTGRLYEYSS 59 69**********************************************96 PP | |||||||
2 | K-box | 26.5 | 2.7e-10 | 99 | 155 | 27 | 83 |
K-box 27 eienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 ++ + ++R+l+ ed++ L+l+eLq++e+ Le l ++ ++K +++ eq++elq+k Spipo0G0120600 99 KVLESTLQLRQLKVEDMGGLTLEELQNMEKSLEAILCQVLETKAKHMDEQTKELQHK 155 4444446789*********************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.114 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.91E-37 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 9.81E-31 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.5E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 8.974 | 86 | 155 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.5E-8 | 94 | 155 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
MGREKTKIRK IDNTTTRQVT FSKRRRSLFK KAEELAILCD AEVGLIVFSS TGRLYEYSSN 60 SMKETIERHN HHSGVALKSV PPSLKLHFQD RIRESLRKKV LESTLQLRQL KVEDMGGLTL 120 EELQNMEKSL EAILCQVLET KAKHMDEQTK ELQHK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_R | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_S | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_A | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_B | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_C | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_D | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_E | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
6c9l_F | 8e-18 | 1 | 73 | 1 | 73 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020090752.1 | 2e-55 | MADS-box transcription factor 22-like isoform X1 | ||||
Refseq | XP_020090753.1 | 2e-55 | MADS-box transcription factor 22-like isoform X1 | ||||
Swissprot | Q9FVC1 | 3e-47 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1D1YHQ0 | 6e-57 | A0A1D1YHQ0_9ARAE; MADS-box protein SVP | ||||
TrEMBL | A0A1D1Z0G2 | 6e-57 | A0A1D1Z0G2_9ARAE; MADS-box protein SVP | ||||
STRING | XP_010277487.1 | 8e-53 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1221 | 36 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-49 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo0G0120600 |