PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Spipo0G0069200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 203aa MW: 23253.7 Da PI: 8.917 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.7 | 6.4e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ien + rqvtfskRr+g+lKKA+ELSvLCda++ +i+fs++gk++e++s Spipo0G0069200 10 KIENPISRQVTFSKRRKGLLKKAHELSVLCDAQIGLIVFSERGKMKEFCS 59 69**********************************************96 PP | |||||||
2 | K-box | 47.8 | 6.2e-17 | 84 | 143 | 12 | 71 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne 71 + ++ ++e++++++++++++ ++ ++G++L+ Lsl L+qLe+qLe s++k+R++K e Spipo0G0069200 84 DNKQQVCTEVTRMRRKNDEIEARIKWYMGQELTGLSLGSLNQLEEQLEMSVNKVRTRKLE 143 57899****************************************************965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.0E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.628 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.43E-39 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 4.97E-31 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.5E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.1E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.2E-14 | 84 | 142 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 9.721 | 86 | 194 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MGRGKIEIRK IENPISRQVT FSKRRKGLLK KAHELSVLCD AQIGLIVFSE RGKMKEFCSD 60 PPSSMKHIIE RYCRANNIGI EDIDNKQQVC TEVTRMRRKN DEIEARIKWY MGQELTGLSL 120 GSLNQLEEQL EMSVNKVRTR KLEQQAVAAA AEYKIADGQV LDEIAPFYNW ESQRNLLQLS 180 PQLQGFRLQG ESQELTLTHQ GF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 6e-16 | 1 | 76 | 1 | 73 | MEF2C |
5f28_B | 6e-16 | 1 | 76 | 1 | 73 | MEF2C |
5f28_C | 6e-16 | 1 | 76 | 1 | 73 | MEF2C |
5f28_D | 6e-16 | 1 | 76 | 1 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020109780.1 | 7e-70 | MADS-box protein AeAP3-2-like isoform X2 | ||||
Swissprot | Q6H711 | 2e-48 | MAD29_ORYSJ; MADS-box transcription factor 29 | ||||
TrEMBL | A0A2H3Z3T1 | 1e-64 | A0A2H3Z3T1_PHODC; MADS-box protein AeAP3-2-like | ||||
STRING | XP_008807981.1 | 2e-65 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1850 | 37 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.3 | 4e-42 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Spipo0G0069200 |