PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim12g087830.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 199aa    MW: 22643.3 Da    PI: 8.9663
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim12g087830.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF823.9e-26959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        kri++k  rqv f+kRr+g+lKKA+E+S+LCd++vav+i+s++g+l+e+ss
  Sopim12g087830.0.1  9 KRIQDKNCRQVAFCKRRKGLLKKAKEISILCDVDVAVVIISNRGRLHEFSS 59
                        79***********************************************96 PP

2K-box40.71e-14811671399
               K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         +ae    e++      e Lq++ R+l   + + L+l +L +Le++L+++l + R++K++l+le+ + l +kek l ee+k L+ +++
  Sopim12g087830.0.1  81 NAEIQVAEVSGFTTMGELLQTTERQLEETNADGLTLTDLIHLENELQTALIHLRARKTHLMLESAKVLHEKEKLLLEEKKHLEDNIA 167
                         555556677777888899****************************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.525161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-28279IPR002100Transcription factor, MADS-box
CDDcd002659.28E-33276No hitNo description
PRINTSPR004041.3E-23323IPR002100Transcription factor, MADS-box
PfamPF003198.7E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.00182172IPR002487Transcription factor, K-box
PfamPF014861.6E-1186166IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009910Biological Processnegative regulation of flower development
GO:0010048Biological Processvernalization response
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MGRRKVEIKR IQDKNCRQVA FCKRRKGLLK KAKEISILCD VDVAVVIISN RGRLHEFSSN  60
NSMTAMLRRY ESHVGAEKEI NAEIQVAEVS GFTTMGELLQ TTERQLEETN ADGLTLTDLI  120
HLENELQTAL IHLRARKTHL MLESAKVLHE KEKLLLEEKK HLEDNIASIK KNTKVNEMSD  180
LPAPHMICGQ QKVTLNFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-16184184MEF2C
5f28_B4e-16184184MEF2C
5f28_C4e-16184184MEF2C
5f28_D4e-16184184MEF2C
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755242e-98HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001352612.11e-143MADS-box transcription factor
TrEMBLA0A3Q7JXP01e-142A0A3Q7JXP0_SOLLC; Uncharacterized protein
STRINGSolyc12g087830.1.11e-143(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65070.13e-32MIKC_MADS family protein