PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g032100.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 202aa    MW: 23104.8 Da    PI: 6.936
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g032100.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.13e-25958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gklye +
  Sopim11g032100.0.1  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELA 58
                        79*********************************************965 PP

2K-box57.84.8e-208417410100
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                         ++++    ++e++ Lk+ei+ Lq+ +  + G + ++++l eL++Le+ Le  + +iRs K+++++++i+ l++ke  l+ +nk+L+ k++e
  Sopim11g032100.0.1  84 KDTQPLDPKEEINMLKNEIDVLQKGLSYMYGGGAGTMTLDELHSLEKYLEIWMYHIRSAKMDIMFQEIQLLKNKEGILEAANKYLQDKIDE 174
                         4555566789******************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-27173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.787161IPR002100Transcription factor, MADS-box
CDDcd002659.56E-40276No hitNo description
PRINTSPR004044.4E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-221056IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.89588178IPR002487Transcription factor, K-box
PfamPF014861.2E-2191172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKLYELATK  60
GSMQGLIERY IKSTKGVEVA EEAKDTQPLD PKEEINMLKN EIDVLQKGLS YMYGGGAGTM  120
TLDELHSLEK YLEIWMYHIR SAKMDIMFQE IQLLKNKEGI LEAANKYLQD KIDEQYTVTN  180
MTQNLTDFQC PLTVQNEIFQ F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-16193192MEF2C
5f28_B8e-16193192MEF2C
5f28_C8e-16193192MEF2C
5f28_D8e-16193192MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987370.0AY098737.2 Lycopersicon esculentum TAGL12 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233764.21e-149TAGL12 transcription factor isoform 1
RefseqXP_015057026.11e-149agamous-like MADS-box protein AGL12 isoform X1
SwissprotQ388413e-80AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A3Q7IV001e-147A0A3Q7IV00_SOLLC; Uncharacterized protein
STRINGSolyc11g032100.1.11e-148(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA98102024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-82AGAMOUS-like 12
Publications ? help Back to Top
  1. Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W
    GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox.
    Plant Physiol., 2004. 136(1): p. 2621-32
    [PMID:15375207]
  2. Pacheco-Escobedo MA, et al.
    Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm.
    Ann. Bot., 2018.
    [PMID:27358290]
  3. GarcĂ­a-Cruz KV, et al.
    The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components.
    Ann. Bot., 2018.
    [PMID:27474508]