PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g010570.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 266aa    MW: 30426.3 Da    PI: 7.3892
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g010570.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.49.1e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+i+n++ rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl++yss
  Sopim11g010570.0.1  9 KKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSS 59
                        68***********************************************96 PP

2K-box53.69.8e-199217319100
               K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                          ++++L kei++  + +R++ Ge+L+ L+++eLqqLe+ Le++l+++ ++K + ++++i++lq+k   l een++Lr++++e
  Sopim11g010570.0.1  92 SNYSRLSKEISEKSHRLRQMRGEELQGLNIEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVME 173
                         6799***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.5E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.501161IPR002100Transcription factor, MADS-box
CDDcd002653.11E-39277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.28E-31375IPR002100Transcription factor, MADS-box
PfamPF003198.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.04487177IPR002487Transcription factor, K-box
PfamPF014861.3E-1692171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MAREKIQIKK IDNSTARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFDYSSS  60
SMKQILERRD LHSKNLEKLD QPSLELQLVE NSNYSRLSKE ISEKSHRLRQ MRGEELQGLN  120
IEELQQLERS LETGLSRVIE RKGDKIMREI NQLQQKGMHL MEENEKLRQQ VMEISNNNNN  180
NNNGYREAGV VIFEPENGFN NNNNEDGQSS ESVTNPCNSI DPPPQDDDSS DTSLKLGLAT  240
LLRLKRSKAR CGYFCMLLEE GEKKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-20166166MEF2C
5f28_B3e-20166166MEF2C
5f28_C3e-20166166MEF2C
5f28_D3e-20166166MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6986610.0JQ698661.1 Capsicum annuum cultivar Maor jointless mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001306770.11e-171MADS-box protein JOINTLESS
SwissprotQ9FUY60.0JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLM1BBZ01e-150M1BBZ0_SOLTU; Uncharacterized protein
STRINGSolyc11g010570.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-101MIKC_MADS family protein
Publications ? help Back to Top
  1. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]