PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g005120.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27791.6 Da    PI: 6.9635
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g005120.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.71.3e-27959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+ rqvtfskRr+g+lKK +ELSvLCda++ +iifs++gkl+ey +
  Sopim11g005120.0.1  9 KRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSTKGKLFEYTT 59
                        79***********************************************75 PP

2K-box56.41.3e-19851671496
               K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                           + + e++k+k+e+ nL+ ++ +++G++L+s ++ eL++Le+qLe+s++kiR++K ell +q+e+l++ ek+l++en+++ +
  Sopim11g005120.0.1  85 RVEQYDEITKMKRETLNLELSLQRYKGDELNSAQYDELNELEKQLENSINKIRARKLELLQQQMENLKRTEKMLEKENHDMCQ 167
                         445689************************************************************************98755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.483161IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-31289IPR002100Transcription factor, MADS-box
CDDcd002656.91E-41279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-29323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.15185178IPR002487Transcription factor, K-box
PfamPF014865.0E-1986168IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRGKIEVKR IENKTSRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFST KGKLFEYTTQ  60
PHSMGEIINK YLQTTGASLP IHDHRVEQYD EITKMKRETL NLELSLQRYK GDELNSAQYD  120
ELNELEKQLE NSINKIRARK LELLQQQMEN LKRTEKMLEK ENHDMCQWLM KYEMYKQQPV  180
AMMEQQEEAA ITELNLLGEQ PLLSQFSFFG DQHQLGTTSN SSAYHLQTSH PFTPSTYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-18171169MEF2C
5f28_B2e-18171169MEF2C
5f28_C2e-18171169MEF2C
5f28_D2e-18171169MEF2C
6byy_A2e-18171169MEF2 CHIMERA
6byy_B2e-18171169MEF2 CHIMERA
6byy_C2e-18171169MEF2 CHIMERA
6byy_D2e-18171169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2124381e-112AC212438.2 Solanum lycopersicum chromosome 11 clone C11HBa0168B23, complete sequence.
GenBankHG9755231e-112HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019066630.11e-178MADS-box protein FBP24-like
SwissprotQ9ATE51e-125FBP24_PETHY; MADS-box protein FBP24
TrEMBLA0A0V0HMT51e-159A0A0V0HMT5_SOLCH; Putative MADS-box protein FBP24-like
STRINGSolyc11g005120.1.11e-177(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.25e-61MIKC_MADS family protein
Publications ? help Back to Top
  1. Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG
    In vivo imaging of MADS-box transcription factor interactions.
    J. Exp. Bot., 2006. 57(1): p. 33-42
    [PMID:16291798]