PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g014250.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 293aa    MW: 33064.9 Da    PI: 8.5933
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g014250.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.95.3e-092873346
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                        rWT+eE + + +a +++ ++    W  +a++++ g+t ++++  ++ 
  Sopim09g014250.0.1 28 RWTPEENKVFEEALALFDKDtpdKWYNVAAMIP-GKTVNDVIKQYRE 73
                        9********************************.********99986 PP

2Myb_DNA-binding47.54e-15137181347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+++++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Sopim09g014250.0.1 137 PWTEEEHKQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 181
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-42375IPR009057Homeodomain-like
PROSITE profilePS512938.2942479IPR017884SANT domain
SMARTSM007174.0E-102577IPR001005SANT/Myb domain
SuperFamilySSF466891.08E-112781IPR009057Homeodomain-like
CDDcd001674.08E-72875No hitNo description
PfamPF002492.2E-72874IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-12128186IPR009057Homeodomain-like
PROSITE profilePS5129420.565130186IPR017930Myb domain
SuperFamilySSF466892.44E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-17133185IPR006447Myb domain, plants
SMARTSM007173.9E-13134184IPR001005SANT/Myb domain
CDDcd001676.89E-11137182No hitNo description
PfamPF002491.3E-12137181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MNREMGYLSP ATYIKNSSWL FEENKGTRWT PEENKVFEEA LALFDKDTPD KWYNVAAMIP  60
GKTVNDVIKQ YRELVEDISD IEAGLIPVPG YTTSNSFTLE WVNNQDAFHG FKQFYGQSGK  120
RGSSNRSSEH ERKKGVPWTE EEHKQFLLGL KKYGKGDWRN ISRNFVTTRT PTQVASHAQK  180
YFIRQLSGGK DKRRSSIHDI TVVNLSESKS TSPEDHKSAP SQQAQQHSKM NGMVKTLCEY  240
NSPNQESDIT FNSSSGGLMA VPFRGAPSYG LEHGMHNIAL QGLQFGNYNT MC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-192694876RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246338.10.0transcription factor DIVARICATA
SwissprotQ8S9H71e-102DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A3Q7HYD00.0A0A3Q7HYD0_SOLLC; Uncharacterized protein
STRINGSolyc09g014250.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-111MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]