PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g067230.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 211aa    MW: 24740.2 Da    PI: 8.6912
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g067230.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.74.3e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien+snrqvt+skRrngilKKA+E+SvLCda v+viif+++gk++e+ss
  Sopim08g067230.0.1  9 KRIENSSNRQVTYSKRRNGILKKAKEISVLCDAHVSVIIFATSGKMHEFSS 59
                        79***********************************************96 PP

2K-box92.38.5e-3169164196
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         y+k +g++l++ak+e+l++e++k+kk ++n+q e+Rhl+Ged++sL+++eL+ Le++Le++l+ iR+k+ne+++++ +++q++e+e+++ n
  Sopim08g067230.0.1  69 YHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDISSLNYRELMILEDALENGLTGIREKQNEFMRMMRKKTQNMEQEQDQLN 159
                         78999999*********************************************************************************** PP

               K-box  92 kaLrk 96 
                          +Lr+
  Sopim08g067230.0.1 160 CQLRQ 164
                         ***98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.001161IPR002100Transcription factor, MADS-box
CDDcd002655.90E-42278No hitNo description
SuperFamilySSF554551.06E-35294IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-1780162IPR002487Transcription factor, K-box
PROSITE profilePS5129714.22682173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGILK KAKEISVLCD AHVSVIIFAT SGKMHEFSST  60
SLVDILDQYH KLTGRRLWDA KHENLDNEIN KVKKDNDNMQ IELRHLKGED ISSLNYRELM  120
ILEDALENGL TGIREKQNEF MRMMRKKTQN MEQEQDQLNC QLRQLEIASM NRNMGEIGEV  180
FEQTRENHDY GQMPFAFRVQ PMQPNLHQRF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A7e-18189183MEF2 CHIMERA
6bz1_B7e-18189183MEF2 CHIMERA
6bz1_C7e-18189183MEF2 CHIMERA
6bz1_D7e-18189183MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8534170.0HQ853417.1 Iochroma cyaneum MADS box transcription factor (GLO1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245202.11e-156floral homeotic protein FBP1
SwissprotQ034881e-138FBP1_PETHY; Floral homeotic protein FBP1
TrEMBLM1ABL01e-150M1ABL0_SOLTU; Uncharacterized protein
STRINGSolyc08g067230.2.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.14e-75MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]
  2. Angenent GC,Busscher M,Franken J,Mol JN,van Tunen AJ
    Differential expression of two MADS box genes in wild-type and mutant petunia flowers.
    Plant Cell, 1992. 4(8): p. 983-93
    [PMID:1356537]