PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g055920.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 29940.5 Da    PI: 9.554
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g055920.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.42.8e-313685150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaev++i+fss+g+lyey+
  Sopim07g055920.0.1 36 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVSLIVFSSRGRLYEYA 85
                        79***********************************************8 PP

2K-box103.92.1e-34103195395
               K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                         ++s+ s++ea+++++qqe++kL+++i+ +q+ +R+++Ge L+sLs ++L++Le +Lek++ ++RskKnell+++ie +qk+e elq++n++
  Sopim07g055920.0.1 103 STSTGSVSEANTQYYQQEASKLRRQIRDIQTYNRQIVGEALGSLSPRDLKNLEGKLEKAIGRVRSKKNELLFSEIELMQKREIELQNANMY 193
                         4556669************************************************************************************ PP

               K-box  94 Lr 95 
                         Lr
  Sopim07g055920.0.1 194 LR 195
                         *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-402887IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.0392888IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-3329104IPR002100Transcription factor, MADS-box
PROSITE patternPS0035003084IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-323050IPR002100Transcription factor, MADS-box
CDDcd002657.04E-4233105No hitNo description
PfamPF003196.4E-263784IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-325065IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-326586IPR002100Transcription factor, MADS-box
PfamPF014864.8E-25112195IPR002487Transcription factor, K-box
PROSITE profilePS5129714.245114205IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MVFPINQELL VDESSSQLRK TSGGTGGGGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY  60
ELSVLCDAEV SLIVFSSRGR LYEYANNSVR ATIDRYKKHH ADSTSTGSVS EANTQYYQQE  120
ASKLRRQIRD IQTYNRQIVG EALGSLSPRD LKNLEGKLEK AIGRVRSKKN ELLFSEIELM  180
QKREIELQNA NMYLRIAEVE RAQEQMNLMP GGGGGGGGGG GGGSDHQYHH QPNYEDARNN  240
FLPVNLLEPN PHYSRRDNGD QTPLQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-2029113289MEF2C
5f28_B4e-2029113289MEF2C
5f28_C4e-2029113289MEF2C
5f28_D4e-2029113289MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987350.0AY098735.2 Lycopersicon esculentum TAGL1 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001300859.11e-173TAGL1 transcription factor
SwissprotQ93XH41e-116MADS1_VITVI; Agamous-like MADS-box protein MADS1
TrEMBLE9JUM21e-172E9JUM2_SOLLC; MADS-box transcription factor ARLEQUIN
STRINGSolyc07g055920.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.12e-94MIKC_MADS family protein
Publications ? help Back to Top
  1. Boss PK,Vivier M,Matsumoto S,Dry IB,Thomas MR
    A cDNA from grapevine (Vitis vinifera L.), which shows homology to AGAMOUS and SHATTERPROOF, is not only expressed in flowers but also throughout berry development.
    Plant Mol. Biol., 2001. 45(5): p. 541-53
    [PMID:11414613]
  2. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  3. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  4. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]