PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g071520.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 426aa    MW: 49109 Da    PI: 6.5768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g071520.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.2e-16155201148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT eEd ll+++v ++G + W+ Ia+++  gR +kqc++rw+++l
  Sopim06g071520.0.1 155 KGQWTIEEDRLLIHLVDKFGVRKWSQIAQMLK-GRIGKQCRERWHNHL 201
                         799****************************9.*************97 PP

2Myb_DNA-binding54.72.3e-17208249245
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         + WT+eEd +l++a+ + G++ W+ Ia++++ gRt++++k++w+
  Sopim06g071520.0.1 208 DFWTEEEDRILIQAHGEVGNK-WAEIAKRLP-GRTENSIKNHWN 249
                         67*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.516150205IPR017930Myb domain
SMARTSM007176.5E-15154203IPR001005SANT/Myb domain
PfamPF002499.0E-16155201IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-31155248IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-27156209IPR009057Homeodomain-like
CDDcd001672.02E-13158201No hitNo description
SMARTSM007172.6E-17206254IPR001005SANT/Myb domain
PROSITE profilePS5129422.239206256IPR017930Myb domain
PfamPF002499.9E-16210249IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-22210255IPR009057Homeodomain-like
CDDcd001672.59E-13210252No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MELDPFFMSN NNMMKQENDD FCIDSKDYLQ DLEHLDHNFS NTFNNFSENF MIDDNTNGTY  60
HDPFDPFSNI QDNFSSLGDF NFINYEVNPF DQENGESSGS KLVMKNNFHV VDGVNVPDDQ  120
SSCVTGDIHH NNLSSSMKKK LGGSRGRPKK SKSSKGQWTI EEDRLLIHLV DKFGVRKWSQ  180
IAQMLKGRIG KQCRERWHNH LRPDIKKDFW TEEEDRILIQ AHGEVGNKWA EIAKRLPGRT  240
ENSIKNHWNA TKRRQFSKRK CRTKWPRPSS LLQNYIKSLN LEKGSTKKSN DTNPNGRVDL  300
IRRVNYPGGS GYTGSIPEKK NENLVNRPNK CHAKVSPKPE AIEFCQGNNN IGDFDLSEVP  360
EFTLDDNFFM EEINIPHVGS SSIMVNENNY EKCMGMEIMP YYEVPTLMQG EVNKEIDLME  420
MISRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-451552554104C-Myb DNA-Binding Domain
1msf_C2e-451552554104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192100.0AC219210.1 Solanum lycopersicum chromosome 6 clone C06HBa0082B05, complete sequence.
GenBankAC2329440.0AC232944.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 6 clone LE_HBa-24A16, complete sequence.
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242162.10.0transcription factor MYB98-like
TrEMBLK4C8M40.0K4C8M4_SOLLC; Uncharacterized protein
STRINGSolyc06g071520.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-71myb domain protein 98