PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g070910.0.1
Organism
Solanum pimpinellifolium
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bHLH
Protein Properties Length: 93aa    MW: 10443.7 Da    PI: 8.5287
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g070910.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.99.9e-1020601454
                        HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                        d+iN+  ++L++llP++ + +s K+s + +L+ +++YIksL
  Sopim06g070910.0.1 20 DQINDLVNKLQQLLPELRNRSSDKVSASRVLQDTCNYIKSL 60
                        79**************8799********************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.896660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.3E-102076IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.2E-72060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.36E-102079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0010086Biological Processembryonic root morphogenesis
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSSR HSGGSRISED QINDLVNKLQ QLLPELRNRS SDKVSASRVL QDTCNYIKSL  60
HREVDDLSDR LSELLESSDT TQAALIRSLL MQ*
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20023194, ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:22339648}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755185e-79HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241574.11e-57transcription factor PRE3
RefseqXP_006354787.11e-57PREDICTED: transcription factor PRE3-like
RefseqXP_015078920.11e-57transcription factor PRE3-like
SwissprotQ9CA641e-36PRE3_ARATH; Transcription factor PRE3
TrEMBLA0A1U8H0G28e-43A0A1U8H0G2_CAPAN; Transcription factor PRE5
TrEMBLA0A2G2WLU48e-43A0A2G2WLU4_CAPBA; Uncharacterized protein
TrEMBLA0A2G2ZCQ98e-43A0A2G2ZCQ9_CAPAN; transcription factor PRE3
TrEMBLA0A2G3AUT98e-43A0A2G3AUT9_CAPCH; Transcription factor PRE5
STRINGSolyc06g070910.2.14e-57(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35324161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74500.16e-27activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1
Publications ? help Back to Top
  1. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Lu KJ,De Rybel B,van Mourik H,Weijers D
    Regulation of intercellular TARGET OF MONOPTEROS 7 protein transport in the Arabidopsis root.
    Development, 2018.
    [PMID:29358212]
  4. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]