PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g059970.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 24867.4 Da    PI: 9.4949
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g059970.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.72.6e-27959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien+ nrqvt+skRrngi+KKA+E+ vLC+a+v++iif+s+gk++ey+s
  Sopim06g059970.0.1  9 KRIENTNNRQVTYSKRRNGIIKKAKEITVLCEAKVSLIIFASSGKMHEYCS 59
                        79***********************************************96 PP

2K-box77.43.6e-2671168198
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yqk+sg++l++ak+e+l++e++++kke++++q ++Rhl+Ged+++L++keL  +e++L+++l++i +k++e+l++  ++ q  e+e+++ +
  Sopim06g059970.0.1  71 YQKASGRRLWDAKHENLSNEIDRIKKENDSMQVKLRHLKGEDINQLTHKELIIMEEALQNGLSSISAKQSEILRMVRKNDQILEEENKQLQ 161
                         8999*************************************************************************************** PP

               K-box  92 kaLrkkl 98 
                          aL++k 
  Sopim06g059970.0.1 162 YALHQKE 168
                         ****996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.1E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
CDDcd002654.12E-39280No hitNo description
SuperFamilySSF554555.89E-35296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-1682163IPR002487Transcription factor, K-box
PROSITE profilePS5129713.71484170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGRGKIEIKR IENTNNRQVT YSKRRNGIIK KAKEITVLCE AKVSLIIFAS SGKMHEYCSP  60
STTISDMLDG YQKASGRRLW DAKHENLSNE IDRIKKENDS MQVKLRHLKG EDINQLTHKE  120
LIIMEEALQN GLSSISAKQS EILRMVRKND QILEEENKQL QYALHQKEMG AIGGSGNMRG  180
IHEEVYHQRE RDYEYQMPFG LRVQPMQPNL HERM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A4e-16191183MEF2 CHIMERA
6bz1_B4e-16191183MEF2 CHIMERA
6bz1_C4e-16191183MEF2 CHIMERA
6bz1_D4e-16191183MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6745310.0DQ674531.1 Lycopersicon esculentum TPI mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234075.21e-158floral homeotic protein PISTILLATA-like
RefseqXP_015078786.11e-158floral homeotic protein PMADS 2
SwissprotQ074741e-136MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLQ0PXC21e-152Q0PXC2_SOLLC; TPI
STRINGSolyc06g059970.2.11e-157(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.19e-87MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]
  2. Kush A,Brunelle A,Shevell D,Chua NH
    The cDNA sequence of two MADS box proteins in Petunia.
    Plant Physiol., 1993. 102(3): p. 1051-2
    [PMID:8278527]