PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g056620.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28660.6 Da    PI: 8.4354
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g056620.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.81.4e-281059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        +ienk+nrqvtfskRr g+ KKA+E+SvLCdaeva+i+fs++gk++eyss
  Sopim05g056620.0.1 10 KIENKINRQVTFSKRRGGLVKKAHEISVLCDAEVALIVFSQKGKIFEYSS 59
                        69**********************************************96 PP

2K-box105.66e-35851769100
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                          e+  +e+++ e++kLk++i+ Lqr+++h++GedL+s+slk+Lq+LeqqL+++lk iRs+Kn+l++e+i+elqkke+++ een++L+kk++
  Sopim05g056620.0.1  85 SESPVQENWSLEYTKLKARIDLLQRNHKHYMGEDLDSMSLKDLQNLEQQLDSALKLIRSRKNQLMHESISELQKKERAILEENNMLTKKIK 175
                         5666789**********************************************************************************98 PP

               K-box 100 e 100
                         e
  Sopim05g056620.0.1 176 E 176
                         7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.819161IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.8E-34288IPR002100Transcription factor, MADS-box
CDDcd002652.53E-40276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-30323IPR002100Transcription factor, MADS-box
PfamPF003196.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-3085174IPR002487Transcription factor, K-box
PROSITE profilePS5129717.44390180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGKVELRK IENKINRQVT FSKRRGGLVK KAHEISVLCD AEVALIVFSQ KGKIFEYSSD  60
SCMEQILERY ERYSYAERRL LANNSESPVQ ENWSLEYTKL KARIDLLQRN HKHYMGEDLD  120
SMSLKDLQNL EQQLDSALKL IRSRKNQLMH ESISELQKKE RAILEENNML TKKIKEKDKI  180
VEQQGEWHQQ TNQVSTSTSF LLQPHQCLNM GGNYQDEVAE ARRNNELDLN LDSLYPLYNM  240
NKHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-20174173MEF2 CHIMERA
6byy_B2e-20174173MEF2 CHIMERA
6byy_C2e-20174173MEF2 CHIMERA
6byy_D2e-20174173MEF2 CHIMERA
6bz1_A2e-20174173MEF2 CHIMERA
6bz1_B2e-20174173MEF2 CHIMERA
6bz1_C2e-20174173MEF2 CHIMERA
6bz1_D2e-20174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4485210.0AF448521.1 Lycopersicon esculentum MADS-box transcription factor MADS-MC (MADS-MC) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234665.11e-180MADS-box transcription factor MADS-MC
SwissprotQ6E6S71e-119AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLA0A2K8GWI81e-179A0A2K8GWI8_9SOLN; MADS-box transcription factor MADS-MC (Fragment)
TrEMBLA0A2K8GYM11e-179A0A2K8GYM1_SOLPE; MADS-box transcription factor MADS-MC (Fragment)
TrEMBLA0A2K8H1691e-179A0A2K8H169_SOLPI; MADS-box transcription factor MADS-MC (Fragment)
TrEMBLA0A2K8H3M11e-179A0A2K8H3M1_9SOLN; MADS-box transcription factor MADS-MC (Fragment)
TrEMBLA0A2K8H8P01e-179A0A2K8H8P0_9SOLA; MADS-box transcription factor MADS-MC (Fragment)
TrEMBLQ8S4L51e-179Q8S4L5_SOLLC; MADS-box transcription factor MADS-MC
STRINGSolyc05g056620.1.11e-180(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.15e-91MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]