PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim05g015750.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 242aa    MW: 27579.3 Da    PI: 9.0678
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim05g015750.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Sopim05g015750.0.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                        79***********************************************96 PP

2K-box94.71.6e-318917514100
               K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                         + s+qqe+ kLk ++e Lqr+qR+llGedL++L+ keL++Le+qL+ slk+iRs++++l+l+q+ + q+ke++l+e+n++L+++l+e
  Sopim05g015750.0.1  89 EISSQQEYLKLKGRYEALQRSQRNLLGEDLGPLNSKELESLERQLDMSLKQIRSTRTQLMLDQLTDYQRKEHALNEANRTLKQRLME 175
                         4579*******************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.05E-33275IPR002100Transcription factor, MADS-box
CDDcd002651.34E-45276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.5E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.9389179IPR002487Transcription factor, K-box
PfamPF014862.6E-2592173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMLKTLERY QKCNYGAPEP NISTREALEI SSQQEYLKLK GRYEALQRSQ RNLLGEDLGP  120
LNSKELESLE RQLDMSLKQI RSTRTQLMLD QLTDYQRKEH ALNEANRTLK QRLMEGSQLN  180
LQWQPNAQDV GYGRQTTQTQ GDGFFHPLDC EPTLQIGYQN DPITVGGAGP SVNNYMAGWL  240
P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A3e-45751761104Developmental protein SEPALLATA 3
4ox0_B3e-45751761104Developmental protein SEPALLATA 3
4ox0_C3e-45751761104Developmental protein SEPALLATA 3
4ox0_D3e-45751761104Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2943300.0AY294330.1 Lycopersicon esculentum MADS-box protein 5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234384.11e-179MADS-box protein 5
RefseqXP_015075132.11e-179agamous-like MADS-box protein AGL9 homolog
SwissprotQ034891e-173AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLQ7Y0391e-178Q7Y039_SOLLC; MADS-box protein 5
STRINGSolyc05g015750.2.11e-178(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.11e-129MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG,Gadella TW,Ferrario S,Busscher M,Angenent GC
    Analysis of MADS box protein-protein interactions in living plant cells.
    Proc. Natl. Acad. Sci. U.S.A., 2002. 99(4): p. 2416-21
    [PMID:11854533]
  2. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]
  3. Angenent GC,Busscher M,Franken J,Mol JN,van Tunen AJ
    Differential expression of two MADS box genes in wild-type and mutant petunia flowers.
    Plant Cell, 1992. 4(8): p. 983-93
    [PMID:1356537]
  4. Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG
    In vivo imaging of MADS-box transcription factor interactions.
    J. Exp. Bot., 2006. 57(1): p. 33-42
    [PMID:16291798]