PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g081000.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 26478.2 Da    PI: 9.7589
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g081000.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.68.1e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ien++nrqvt+skRrng++KKA+EL vLCda+v+++++sstgkl+e++s
  Sopim04g081000.0.1  9 KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFIS 59
                        68***********************************************86 PP

2K-box93.43.8e-3171169199
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yqk+ g++ +++++e++q++l+kLk+ ++nL++e+R+++Ge+L++L++++L++L +++++slk iR++K +++ +qie+ +kk ++++e+n
  Sopim04g081000.0.1  71 YQKTIGVDIWTTHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNYEQLEELMENVDNSLKLIRERKFKVIGNQIETYRKKVRNVEEIN 161
                         78888999*********************************************************************************** PP

               K-box  92 kaLrkkle 99 
                         ++L  +++
  Sopim04g081000.0.1 162 RNLLLEFD 169
                         ***87765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.609161IPR002100Transcription factor, MADS-box
CDDcd002651.97E-38280No hitNo description
PRINTSPR004041.5E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-35395IPR002100Transcription factor, MADS-box
PfamPF003197.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-2082167IPR002487Transcription factor, K-box
PROSITE profilePS5129715.99284174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARGKIQIKK IENQTNRQVT YSKRRNGLFK KANELTVLCD AKVSIVMISS TGKLHEFISP  60
SITTKQLFDL YQKTIGVDIW TTHYEKMQEQ LRKLKDVNRN LRKEIRQRMG ESLNDLNYEQ  120
LEELMENVDN SLKLIRERKF KVIGNQIETY RKKVRNVEEI NRNLLLEFDA RQEDPYGGLV  180
EHDGDYNSVL GFPTGGPRIL DLRLQPNNNY HNHLHSGGGS DITTFALG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-14162162MEF2C
5f28_B4e-14162162MEF2C
5f28_C4e-14162162MEF2C
5f28_D4e-14162162MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development. Necessary for the normal development of petals. Absence of the PMADS1 protein causes transformation of petals into sepals.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ6745320.0DQ674532.1 Lycopersicon esculentum TAP3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234077.21e-168floral homeotic protein DEFICIENS
RefseqXP_015072271.11e-168floral homeotic protein PMADS 1
SwissprotQ074721e-136MADS1_PETHY; Floral homeotic protein PMADS 1
TrEMBLQ2UVA81e-167Q2UVA8_SOLLC; Floral homeotic protein DEFICIENS
STRINGSolyc04g081000.2.11e-168(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23142451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.14e-96MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]
  2. Kush A,Brunelle A,Shevell D,Chua NH
    The cDNA sequence of two MADS box proteins in Petunia.
    Plant Physiol., 1993. 102(3): p. 1051-2
    [PMID:8278527]