PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g078300.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 335aa    MW: 38130.7 Da    PI: 5.9615
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g078300.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF901.2e-28958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        k+ien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g++ ++s
  Sopim04g078300.0.1  9 KKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRVSTFS 58
                        68***********************************************8 PP

2K-box17.41.8e-07102174174
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 
                         yq+ s+ s  +++ e+ qqe+ + k ++e ++r +R + G   e  ++ e q  e+ L++ lk++ ++K+ +l 
  Sopim04g078300.0.1 102 YQAPSSPSSVDSHIEEFQQEIIRYKTQVEDMERRLRMYEGGFCEITTVCEAQYREEILQETLKQVQARKQ-VLE 174
                         5666777788999******************************************************995.444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.857161IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-38160IPR002100Transcription factor, MADS-box
CDDcd002656.78E-39275No hitNo description
SuperFamilySSF554551.7E-30282IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003196.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGRVKLQIKK IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRVSTFSGN  60
KSIEDIMARY VNLPEHDRGR LHNQEHLQRA IAKLKCEADR TYQAPSSPSS VDSHIEEFQQ  120
EIIRYKTQVE DMERRLRMYE GGFCEITTVC EAQYREEILQ ETLKQVQARK QVLEENYHSP  180
QTQNTTQPQM DFSGQNVNMV NNVATSDAIA NSTFMDWVPH SQRDPHVQIL NFLDSSGLLP  240
FRDEADQHML PPSLNQLHGV NVPAGTDHLS SNSRFDQNNP PRPSSFDGII DVNNAPWPPL  300
YTTGDDPFPV SQPRERAILE LFLSQLTPVN QDHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-16189190Myocyte-specific enhancer factor 2B
1tqe_Q6e-16189190Myocyte-specific enhancer factor 2B
1tqe_R6e-16189190Myocyte-specific enhancer factor 2B
1tqe_S6e-16189190Myocyte-specific enhancer factor 2B
6c9l_A6e-16189190Myocyte-specific enhancer factor 2B
6c9l_B6e-16189190Myocyte-specific enhancer factor 2B
6c9l_C6e-16189190Myocyte-specific enhancer factor 2B
6c9l_D6e-16189190Myocyte-specific enhancer factor 2B
6c9l_E6e-16189190Myocyte-specific enhancer factor 2B
6c9l_F6e-16189190Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-100HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010320313.10.0agamous-like MADS-box protein AGL104 isoform X1
TrEMBLA0A3Q7G8U50.0A0A3Q7G8U5_SOLLC; Uncharacterized protein
STRINGSolyc04g078300.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61831925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-53AGAMOUS-like 104