PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g014830.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 554aa    MW: 61845.1 Da    PI: 7.5117
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g014830.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS421.95.3e-1291745441374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l+elL++cAeav++ d++ a+ l+  l++++s +g+pmqRl ay++e+L+arl++s+s++yk+l+++e +   sse l++++++++++P++
  Sopim04g014830.0.1 174 LKELLVACAEAVDEADTSTAEVLMDALEKRVSVYGEPMQRLSAYMLEGLRARLLSSGSNIYKKLKCNEPT---SSELLSYMQVLYHITPYF 261
                         5799*****************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf+++ aN  I ea+++e+r+HiiDf+i qG QW+ L++ La Rp+gpp lRiTg+++++s   +   l+ +gerLa++A+++gvpfef++
  Sopim04g014830.0.1 262 KFAYMSANVVISEAMKNENRIHIIDFQIAQGSQWVFLIHYLARRPGGPPFLRITGIDDSQSAhaRGGGLQLVGERLASIAKSCGVPFEFHT 352
                         **********************************************************9988889999*********************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +a +  +++le+Lrv++gE+laVn+ ++lh+++desvs+ ++rd++L+lvkslsPk+v +veqe+++n+++Fl rf e+l+y+ a+f+s+
  Sopim04g014830.0.1 353 -AALSGCMVKLENLRVRHGESLAVNFPYMLHHMPDESVSTMNHRDRLLRLVKSLSPKIVALVEQEMNTNTAPFLPRFRETLDYHKAIFESV 442
                         .899*************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++ pr++ +ri  E+++++r++vn++acega+r+erhe ++kWr+rl +aGF+p pls ++a+ +k +l++++s+ y++ e++g+l++gW
  Sopim04g014830.0.1 443 DVTRPRNDMQRIRSEEHCIARDVVNLIACEGADRVERHEVFGKWRSRLLMAGFTPCPLSPSVAEAIKVMLKEYSSN-YKLAESQGALYIGW 532
                         **************************************************************************77.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         ++r+L + SaW+
  Sopim04g014830.0.1 533 NNRALATSSAWQ 544
                         ***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.145148525IPR005202Transcription factor GRAS
PfamPF035141.8E-126174544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MQASQGPQRS CSVHKLYNKP MQQVQQNYTP CRASDNSNYN DGSNSQAQVS LTTENEKFFT  60
VDTFPATDCA IYDGDPSVSV SSNRSPFSSQ CSQSNMFEQR RSYEKTAGSP VSLCSGVDDS  120
NGKKHELREL NNKLLRPESD IDDSCSCSLN GVVSKHFSLT RRNQVLDVAS RLDLKELLVA  180
CAEAVDEADT STAEVLMDAL EKRVSVYGEP MQRLSAYMLE GLRARLLSSG SNIYKKLKCN  240
EPTSSELLSY MQVLYHITPY FKFAYMSANV VISEAMKNEN RIHIIDFQIA QGSQWVFLIH  300
YLARRPGGPP FLRITGIDDS QSAHARGGGL QLVGERLASI AKSCGVPFEF HTAALSGCMV  360
KLENLRVRHG ESLAVNFPYM LHHMPDESVS TMNHRDRLLR LVKSLSPKIV ALVEQEMNTN  420
TAPFLPRFRE TLDYHKAIFE SVDVTRPRND MQRIRSEEHC IARDVVNLIA CEGADRVERH  480
EVFGKWRSRL LMAGFTPCPL SPSVAEAIKV MLKEYSSNYK LAESQGALYI GWNNRALATS  540
SAWQLPHSLP LGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6018154326378Protein SCARECROW
5b3h_A2e-6018154325377Protein SCARECROW
5b3h_D2e-6018154325377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004236663.10.0scarecrow-like protein 21
RefseqXP_025886403.10.0scarecrow-like protein 21
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A3Q7G1F00.0A0A3Q7G1F0_SOLLC; Uncharacterized protein
STRINGSolyc04g014830.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13