PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g114830.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28614.3 Da    PI: 9.3112
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g114830.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.16.3e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +i+fs++gkl+eys+
  Sopim03g114830.0.1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIVFSTKGKLFEYST 59
                        79***********************************************96 PP

2K-box101.89.5e-34831749100
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                         ++  +  s++ e+akLk+++e Lqr+q+h+ Ge+L++Ls+keLq+Le+qL+++lk+iRs+Kn+l++e+i+elqkk k+lqe+n++L+k+++
  Sopim03g114830.0.1  83 TDIITPGSWTLEHAKLKARLEVLQRNQKHYAGEELDTLSMKELQNLEHQLDSALKHIRSRKNQLMHESISELQKKDKALQEQNNNLSKQVK 173
                         555566789********************************************************************************98 PP

               K-box 100 e 100
                         e
  Sopim03g114830.0.1 174 E 174
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.184161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.28E-34287IPR002100Transcription factor, MADS-box
CDDcd002659.93E-42279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-31323IPR002100Transcription factor, MADS-box
PfamPF003196.7E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129716.20288178IPR002487Transcription factor, K-box
PfamPF014868.1E-2890172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVGLIVFST KGKLFEYSTD  60
SCMERILERY ERYSYAERQL NATDIITPGS WTLEHAKLKA RLEVLQRNQK HYAGEELDTL  120
SMKELQNLEH QLDSALKHIR SRKNQLMHES ISELQKKDKA LQEQNNNLSK QVKEREKEMA  180
QQTPWEQQSH DHLNSSSFVL PHPFNNLHIG EAYPNAGDNG EVEGSSRQQQ QNSASVMPPW  240
MLRHLNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-22186185MEF2 CHIMERA
6byy_B1e-22186185MEF2 CHIMERA
6byy_C1e-22186185MEF2 CHIMERA
6byy_D1e-22186185MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0140570.0BT014057.1 Lycopersicon esculentum clone 133155F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001294867.10.0transcription factor FRUITFULL
SwissprotQ424291e-144AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A3Q7FTD80.0A0A3Q7FTD8_SOLLC; Uncharacterized protein
STRINGSolyc03g114830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-106AGAMOUS-like 8
Publications ? help Back to Top
  1. Kang SG,Hannapel DJ
    Nucleotide sequences of novel potato (Solanum tuberosum L.) MADS-box cDNAs and their expression in vegetative organs.
    Gene, 1995. 166(2): p. 329-30
    [PMID:8543185]