PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim03g006830.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25369.2 Da    PI: 9.4562
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim03g006830.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.54.2e-29252151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien++ rqvtfskRrng+ KKA+ELSvLCdaeva iifs++g+lye++s
  Sopim03g006830.0.1  2 KRIENSTSRQVTFSKRRNGLTKKAYELSVLCDAEVAFIIFSHKGRLYEFAS 52
                        79***********************************************86 PP

2K-box74.53e-25781651097
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                          e+ +e+l++e a++ k+ie L+ ++R+l+G++L+s+s+ eL+ + +qLe+ lk iR++K++l++e+ie l+ ke+ l ++n +Lr+k
  Sopim03g006830.0.1  78 LEHYMENLKHETANMAKKIEILEISKRKLMGQGLGSCSMDELEDIDSQLERTLKIIRARKTQLFKEEIESLKAKERLLLQQNASLREK 165
                         466789********************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd002651.80E-37163No hitNo description
SuperFamilySSF554555.76E-30181IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-29153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.553154IPR002100Transcription factor, MADS-box
PfamPF003191.0E-26350IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-171631IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-173152IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2480166IPR002487Transcription factor, K-box
PROSITE profilePS5129714.47182172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009838Biological Processabscission
GO:0009909Biological Processregulation of flower development
GO:0010150Biological Processleaf senescence
GO:0080187Biological Processfloral organ senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MKRIENSTSR QVTFSKRRNG LTKKAYELSV LCDAEVAFII FSHKGRLYEF ASSNMQKIIE  60
RYRGRARETT TVDKSTELEH YMENLKHETA NMAKKIEILE ISKRKLMGQG LGSCSMDELE  120
DIDSQLERTL KIIRARKTQL FKEEIESLKA KERLLLQQNA SLREKCGLRP MLSESASAPE  180
PIPAPPSTPP AQSKERGNCS QSTKSWEVET ELFIGLPQTR CL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A8e-18362968Myocyte-specific enhancer factor 2A
3mu6_B8e-18362968Myocyte-specific enhancer factor 2A
3mu6_C8e-18362968Myocyte-specific enhancer factor 2A
3mu6_D8e-18362968Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00576DAPTransfer from AT5G62165Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7094440.0KF709444.1 Solanum lycopersicum MADS-box transcription factor FYFL (FYFL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001276829.11e-163MADS-box protein SOC1-like
SwissprotQ9FIS12e-71AGL42_ARATH; MADS-box protein AGL42
TrEMBLW5S1851e-162W5S185_SOLLC; MADS-box transcription factor FYFL
STRINGSolyc03g006830.2.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.33e-72AGAMOUS-like 42