PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g089210.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 28589.2 Da    PI: 9.8671
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g089210.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.3e-29959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+ rqvtfskRr g+lKKA+E+SvLCda+va+i+fs++gkl+eyss
  Sopim02g089210.0.1  9 KRIENKISRQVTFSKRRSGLLKKANEISVLCDADVALIVFSTKGKLFEYSS 59
                        79***********************************************96 PP

2K-box102.65e-34771752100
               K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                         ++++ +++++   e+++ e+ kL ++ie Lqr++Rh++G+dL++Lsl+eLq++eqq+++slk+iRs+Kn+l++e+i+elqkkek+lqe+n+
  Sopim02g089210.0.1  77 AERQMNANDSDPKENWSVEYPKLMSRIELLQRNIRHYMGQDLDPLSLRELQSIEQQIDTSLKRIRSRKNQLMHESISELQKKEKALQEQNN 167
                         6677777888889****************************************************************************** PP

               K-box  93 aLrkklee 100
                          ++kkl+e
  Sopim02g089210.0.1 168 LITKKLKE 175
                         *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.763161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-33291IPR002100Transcription factor, MADS-box
CDDcd002653.36E-40280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-30323IPR002100Transcription factor, MADS-box
PfamPF003194.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-303859IPR002100Transcription factor, MADS-box
PfamPF014868.3E-2985173IPR002487Transcription factor, K-box
PROSITE profilePS5129716.68689179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRGRVELKR IENKISRQVT FSKRRSGLLK KANEISVLCD ADVALIVFST KGKLFEYSSN  60
DSSMESILER YERCSYAERQ MNANDSDPKE NWSVEYPKLM SRIELLQRNI RHYMGQDLDP  120
LSLRELQSIE QQIDTSLKRI RSRKNQLMHE SISELQKKEK ALQEQNNLIT KKLKENEKTQ  180
PNSSGQNSAT VHVFPSHSHH QLPNLTIGGA FGGMNRDGSG QAHHYPGSNN NNNNSSLIPP  240
WMLRHVSNEG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-19171169MEF2C
5f28_B2e-19171169MEF2C
5f28_C2e-19171169MEF2C
5f28_D2e-19171169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0131260.0BT013126.1 Lycopersicon esculentum clone 114416F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316206.10.0truncated transcription factor CAULIFLOWER A
SwissprotD7SMN61e-103FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBLM0ZLS21e-158M0ZLS2_SOLTU; Uncharacterized protein
STRINGSolyc02g089210.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-88MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]