PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g089200.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28481.3 Da    PI: 8.287
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g089200.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.74.9e-31959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  Sopim02g089200.0.1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSNRGKLYEFCS 59
                        79***********************************************96 PP

2K-box92.47.9e-31781744100
               K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          + ++  + +++s+++e+ kLk+++e+Lqr qRhllG++L++L++ +L++Le qL++slk+iRs++++++l+q+++lq kek  +e+nk L
  Sopim02g089200.0.1  78 LEVNRSIKDNEQSSYREYLKLKAKYESLQRYQRHLLGDELGPLTIDDLEHLEVQLDTSLKHIRSTRTQMMLDQLSDLQTKEKLWNEANKVL 168
                         56666677889******************************************************************************** PP

               K-box  95 rkklee 100
                         ++k+ee
  Sopim02g089200.0.1 169 ERKMEE 174
                         ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.347161IPR002100Transcription factor, MADS-box
CDDcd002657.72E-44278No hitNo description
SuperFamilySSF554552.35E-33278IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2585172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.96888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALLVFSN RGKLYEFCST  60
NNMLKTLDRY QKCSYGTLEV NRSIKDNEQS SYREYLKLKA KYESLQRYQR HLLGDELGPL  120
TIDDLEHLEV QLDTSLKHIR STRTQMMLDQ LSDLQTKEKL WNEANKVLER KMEEIYAENN  180
MQQAWGGGEQ SLNYGQQQHP QSQGFFQPLE CNSSLQIGYD PITTSSQITA VTNAQNVNGM  240
IPGWML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A2e-2775168197Developmental protein SEPALLATA 3
4ox0_B2e-2775168197Developmental protein SEPALLATA 3
4ox0_C2e-2775168197Developmental protein SEPALLATA 3
4ox0_D2e-2775168197Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3020150.0AJ302015.1 Lycopersicon esculentum mRNA for MADS-box protein (TM29 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001233911.10.0developmental protein SEPALLATA 1-like
SwissprotQ8LLR21e-130MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBLQ8VXG00.0Q8VXG0_SOLLC; MADS-box protein
STRINGSolyc02g089200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.11e-101MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]