PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g084630.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 26092.7 Da    PI: 9.7129
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g084630.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.91e-26959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ien++nrqvt+skRrngi+KKA+EL vLCda++++i++sst k +ey s
  Sopim02g084630.0.1  9 KKIENSTNRQVTYSKRRNGIFKKAKELTVLCDAKISLIMLSSTRKYHEYTS 59
                        68***********************************************75 PP

2K-box83.45.1e-2871168198
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yq++ g++ ++ ++e++q++l++Lk+ +++L+re+R++ Ged++ L+l+eL +L++++ +s+ +iR++K++++++q+++ +kk ++l+e+n
  Sopim02g084630.0.1  71 YQSALGVDIWSIHYEKMQENLKRLKEINNKLRREIRQRTGEDMSGLNLQELCHLQENITESVAEIRERKYHVIKNQTDTCKKKARNLEEQN 161
                         67888999*********************************************************************************** PP

               K-box  92 kaLrkkl 98 
                          +L   l
  Sopim02g084630.0.1 162 GNLVLDL 168
                         *997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.22E-35295IPR002100Transcription factor, MADS-box
CDDcd002655.78E-37280No hitNo description
PRINTSPR004048.0E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-263859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-2183165IPR002487Transcription factor, K-box
PROSITE profilePS5129714.83384174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGRGKIEIKK IENSTNRQVT YSKRRNGIFK KAKELTVLCD AKISLIMLSS TRKYHEYTSP  60
NTTTKKMIDQ YQSALGVDIW SIHYEKMQEN LKRLKEINNK LRREIRQRTG EDMSGLNLQE  120
LCHLQENITE SVAEIRERKY HVIKNQTDTC KKKARNLEEQ NGNLVLDLEA KCEDPKYGVV  180
ENEGHYHSAV AFANGVHNLY AFRLQPLHPN LQNEGGFGSR DLRLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-14161161MEF2C
5f28_B1e-14161161MEF2C
5f28_C1e-14161161MEF2C
5f28_D1e-14161161MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX607590.0X60759.1 L.esculentum TDR6 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001311309.11e-168TDR6 transcription factor
SwissprotQ003J21e-119TM6_VITVI; Agamous-like MADS-box protein TM6
TrEMBLA0A3Q7F7881e-166A0A3Q7F788_SOLLC; Uncharacterized protein
STRINGSolyc02g084630.2.11e-167(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23142451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.13e-72MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]