PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g071730.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 249aa    MW: 28723.6 Da    PI: 9.966
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g071730.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.74.8e-312574150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs++g+lyey+
  Sopim02g071730.0.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSNRGRLYEYA 74
                        79***********************************************8 PP

2K-box112.73.6e-37921893100
               K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                         +s++ s++ea+a+++qqe++kL+++i nL +++R+++Ge L  ++lkeL++Leq++ek+++kiRskKnell+++ie++qk+e +l+++n++
  Sopim02g071730.0.1  92 SSNTGSVSEANAQYYQQEASKLRAQIGNLMNQNRNMMGEALAGMKLKELKNLEQRIEKGISKIRSKKNELLFAEIEYMQKREVDLHNNNQY 182
                         3445559************************************************************************************ PP

               K-box  94 Lrkklee 100
                         Lr+k++e
  Sopim02g071730.0.1 183 LRAKIAE 189
                         ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.4451777IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-401776IPR002100Transcription factor, MADS-box
CDDcd002652.30E-451894No hitNo description
SuperFamilySSF554556.15E-331890IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-331939IPR002100Transcription factor, MADS-box
PfamPF003191.4E-262673IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-335475IPR002100Transcription factor, MADS-box
PfamPF014865.6E-27101187IPR002487Transcription factor, K-box
PROSITE profilePS5129714.55103193IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDFQSDLTRE ISPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LVVFSNRGRL YEYANNSVKA TIERYKKACS DSSNTGSVSE ANAQYYQQEA SKLRAQIGNL  120
MNQNRNMMGE ALAGMKLKEL KNLEQRIEKG ISKIRSKKNE LLFAEIEYMQ KREVDLHNNN  180
QYLRAKIAET ERAQHQHQQM NLMPGSSSNY HELVPPPQQF DTRNYLQVNG LQTNNHYPRQ  240
DQPPIQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P6e-201785169Myocyte-specific enhancer factor 2B
1tqe_Q6e-201785169Myocyte-specific enhancer factor 2B
1tqe_R6e-201785169Myocyte-specific enhancer factor 2B
1tqe_S6e-201785169Myocyte-specific enhancer factor 2B
6byy_A9e-201785169MEF2 CHIMERA
6byy_B9e-201785169MEF2 CHIMERA
6byy_C9e-201785169MEF2 CHIMERA
6byy_D9e-201785169MEF2 CHIMERA
6c9l_A6e-201785169Myocyte-specific enhancer factor 2B
6c9l_B6e-201785169Myocyte-specific enhancer factor 2B
6c9l_C6e-201785169Myocyte-specific enhancer factor 2B
6c9l_D6e-201785169Myocyte-specific enhancer factor 2B
6c9l_E6e-201785169Myocyte-specific enhancer factor 2B
6c9l_F6e-201785169Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankTOMTAG1A0.0L26295.1 Lycopersicon esculentum TAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266181.10.0floral homeotic protein AGAMOUS isoform 2
SwissprotQ401680.0AG_SOLLC; Floral homeotic protein AGAMOUS
TrEMBLM1CRK71e-176M1CRK7_SOLTU; Uncharacterized protein
STRINGSolyc02g071730.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-123MIKC_MADS family protein
Publications ? help Back to Top
  1. Pan IL,McQuinn R,Giovannoni JJ,Irish VF
    Functional diversification of AGAMOUS lineage genes in regulating tomato flower and fruit development.
    J. Exp. Bot., 2010. 61(6): p. 1795-806
    [PMID:20335407]
  2. Gimenez E, et al.
    TOMATO AGAMOUS1 and ARLEQUIN/TOMATO AGAMOUS-LIKE1 MADS-box genes have redundant and divergent functions required for tomato reproductive development.
    Plant Mol. Biol., 2016. 91(4-5): p. 513-31
    [PMID:27125648]