PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g065730.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27368.1 Da    PI: 10.1154
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g065730.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.24.4e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krienk+ rqvtfskRr g+lKK +E+SvLCdaeva+i+fss+gkl+eys+
  Sopim02g065730.0.1  9 KRIENKISRQVTFSKRRSGLLKKTNEISVLCDAEVALIVFSSNGKLFEYST 59
                        79***********************************************96 PP

2K-box94.12.3e-31781717100
               K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                          +l+++  e+++ e+ kL +++e Lqr++Rh++GedL+  +l+e + Le+qL+++lk++RskKn+l++e+i++lqkkekelq++n+ +++k
  Sopim02g065730.0.1  78 MNLNTTYKENWTLEYPKLMARVELLQRNIRHFMGEDLDAFNLREFRGLEKQLDTALKRVRSKKNQLMHESISQLQKKEKELQQRNNLISNK 168
                         34788899*********************************************************************************99 PP

               K-box  98 lee 100
                         l+e
  Sopim02g065730.0.1 169 LKE 171
                         986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SMARTSM004326.9E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-33289IPR002100Transcription factor, MADS-box
CDDcd002657.65E-41275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-293859IPR002100Transcription factor, MADS-box
PfamPF014863.1E-2583169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.22885175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGRVEMKR IENKISRQVT FSKRRSGLLK KTNEISVLCD AEVALIVFSS NGKLFEYSTQ  60
SSMENILERY ENYSYEEMNL NTTYKENWTL EYPKLMARVE LLQRNIRHFM GEDLDAFNLR  120
EFRGLEKQLD TALKRVRSKK NQLMHESISQ LQKKEKELQQ RNNLISNKLK ENEKKQIVQT  180
NPGQSSTMTF LLQSPTVTNQ TIGGPSQATD QSQNRDGYNS LMPPWMFHHV HNKG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-20174173MEF2 CHIMERA
6byy_B7e-20174173MEF2 CHIMERA
6byy_C7e-20174173MEF2 CHIMERA
6byy_D7e-20174173MEF2 CHIMERA
6bz1_A8e-20174173MEF2 CHIMERA
6bz1_B8e-20174173MEF2 CHIMERA
6bz1_C8e-20174173MEF2 CHIMERA
6bz1_D8e-20174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755143e-98HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233393.11e-174truncated transcription factor CAULIFLOWER A-like
SwissprotD7SMN69e-91FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBLA0A3Q7EZR51e-173A0A3Q7EZR5_SOLLC; Uncharacterized protein
STRINGSolyc02g065730.1.11e-174(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4992397
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.11e-77AGAMOUS-like 8
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]