PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g029710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 474aa    MW: 52620.8 Da    PI: 6.0832
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g029710.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.47.6e-142976148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W + Ed +l d+v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Sopen11g029710.1 29 KGPWLKAEDAILRDYVAEYGEGNWSSVHRRTGLARCGKSCRLRWANHL 76
                      79******************************************9986 PP

2Myb_DNA-binding52.98.7e-1782125146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++T+eE++l+v  ++q G++ W++Ia++++ gRt++++k++w++
  Sopen11g029710.1  82 KGAFTQEEEQLIVAMHAQIGNK-WARIASEFP-GRTDNDIKNFWNT 125
                       799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4182476IPR017930Myb domain
SuperFamilySSF466891.09E-2726123IPR009057Homeodomain-like
SMARTSM007171.0E-112878IPR001005SANT/Myb domain
PfamPF002492.7E-122976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-213083IPR009057Homeodomain-like
CDDcd001671.12E-93176No hitNo description
PROSITE profilePS5129424.3577131IPR017930Myb domain
SMARTSM007173.1E-1681129IPR001005SANT/Myb domain
PfamPF002497.7E-1582125IPR001005SANT/Myb domain
CDDcd001671.50E-1184127No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2384130IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MTSEVGMNST SVEEANAGGN IRRGTPLKKG PWLKAEDAIL RDYVAEYGEG NWSSVHRRTG  60
LARCGKSCRL RWANHLKPYL KKGAFTQEEE QLIVAMHAQI GNKWARIASE FPGRTDNDIK  120
NFWNTRLKRQ RREEKYMLSP GVFFREFSED KQNKELATSS SANSLPHLLP INNVEIPTAE  180
NRNFEPSQQL YPPRLLNNGF SSFLGTPATS LRDQGLNSSW NTHSVPSTVH SSKRTQGLES  240
WFSNRNVDLS QAHHQYQNDG SFFTQSLGFS SLHTHNLTSN YHPSSASEIP GIQASSSEHR  300
LKGKLELPSF QTPMTSWDSA SSVPSIESSS TFIQSPPNEY TDSCSLSPQS SDLLHAILYG  360
SQTPKASSSN SYQETSRDVV PDSCPVLRQI QWGTDPDAIT PSGHAITSVF SEYTPSSGGS  420
LEDHQSIAPL IGCNVNQEMA NFTPTAGNND TSNDDLFSET DMYFSPSDWL HDLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-272713025127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015057287.10.0transcription factor GAMYB-like isoform X1
TrEMBLA0A3Q7J0M00.0A0A3Q7J0M0_SOLLC; Uncharacterized protein
STRINGSolyc11g072060.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26930.11e-56myb domain protein 97