PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen11g002650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 210aa    MW: 24559.5 Da    PI: 6.9693
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen11g002650.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.34.6e-102366344
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                       WT  Ed+l+ +a  ++  +   +W +Ia++++ gRt++++  ++
  Sopen11g002650.1 23 TWTRFEDKLFEQALVMYSENdieRWQKIANHVP-GRTPEDVMAHY 66
                      7********************************.********998 PP

2Myb_DNA-binding44.43.8e-14119163347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Sopen11g002650.1 119 PWTEEEHRLFLIGLDKYGKGDWRSISRNVVVTRTPTQVASHAQKY 163
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.66E-121870IPR009057Homeodomain-like
PROSITE profilePS512938.7451973IPR017884SANT domain
SMARTSM007179.3E-92072IPR001005SANT/Myb domain
CDDcd001671.15E-82366No hitNo description
PfamPF002492.1E-82366IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-72370IPR009057Homeodomain-like
PROSITE profilePS5129421.268112168IPR017930Myb domain
SuperFamilySSF466893.87E-17114169IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-17115167IPR006447Myb domain, plants
SMARTSM007177.3E-11116166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11116162IPR009057Homeodomain-like
PfamPF002494.3E-12119163IPR001005SANT/Myb domain
CDDcd001673.83E-9119163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MMYPANNRWL IGESPAMIHP NSTWTRFEDK LFEQALVMYS ENDIERWQKI ANHVPGRTPE  60
DVMAHYDALV HDVFEIDSGR VEPPSYPDDL FDWESDCKTN QISFGTNKKH EVERKKGTPW  120
TEEEHRLFLI GLDKYGKGDW RSISRNVVVT RTPTQVASHA QKYYLRQQSM KKERKRSSIH  180
DITTAVDTKI VPPQNSLQNQ GGYQNFNFPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1324861173RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0128560.0BT012856.1 Lycopersicon esculentum clone 113942F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015056635.11e-159transcription factor SRM1-like
SwissprotQ9FNN62e-56SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A3Q7JHW81e-157A0A3Q7JHW8_SOLLC; Uncharacterized protein
STRINGSolyc11g006720.1.11e-158(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-71MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]