PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen10g028480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 279aa    MW: 32135.9 Da    PI: 8.8583
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen10g028480.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.92.3e-082873346
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      +WT eE + + da +++ ++   +W  +a++++ g+t ++++  ++ 
  Sopen10g028480.1 28 NWTVEENKMFEDALALFDKEtpdRWYNVAAMIP-GKTVNEVIKQYRE 73
                      8*****************99*************.********99986 PP

2Myb_DNA-binding45.61.6e-14148192347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Sopen10g028480.1 148 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 192
                       7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.5282175IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.1E-42575IPR009057Homeodomain-like
SMARTSM007172.9E-102577IPR001005SANT/Myb domain
SuperFamilySSF466895.83E-122782IPR009057Homeodomain-like
CDDcd001673.69E-72875No hitNo description
PfamPF002499.2E-72874IPR001005SANT/Myb domain
PROSITE profilePS5129418.67141197IPR017930Myb domain
SuperFamilySSF466891.45E-17143196IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-17144196IPR006447Myb domain, plants
SMARTSM007173.2E-12145195IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-12146192IPR009057Homeodomain-like
PfamPF002496.4E-12148192IPR001005SANT/Myb domain
CDDcd001671.29E-10148193No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGFLSPPPEE TTYLRNSNWL FEENKGTNWT VEENKMFEDA LALFDKETPD RWYNVAAMIP  60
GKTVNEVIKQ YRELVDDVTA IEAGLIPVPA SYMTTTSCTT NSFTLDWINH DQEIGEFHDF  120
NKRFHGPSHG KRNTSNRSSE YERKKGIPWT EEEHRQFLLG LKKYGKGDWR NISRNFVTTR  180
TPTQVASHAQ KYFIRQVSGG KDKRRSSIHD ITTVNLTEMK ENHTSSNSPE NSVPSPQKPH  240
NLSNQKSHIG FKTYGLKLHQ HGMHSVILQG LQFGQYNTM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-172695876RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089364.10.0transcription factor DIVARICATA-like
SwissprotQ8S9H74e-85DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A3Q7IK010.0A0A3Q7IK01_SOLLC; Uncharacterized protein
STRINGSolyc10g076820.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.18e-99MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]