PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen09g003210.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 122aa MW: 14427.7 Da PI: 10.4306 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.5 | 9.5e-16 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W eEde+l+ +++ lG ++W++ a+ g++R++k+c++rw +yl Sopen09g003210.1 8 KGPWLDEEDERLAYVIAILGERRWDALAKASGLRRSGKSCRLRWMNYL 55 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.6 | 2.6e-17 | 64 | 106 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T++E+ l++++ kqlG++ W++Ia+ ++ gRt++++k++w+++l Sopen09g003210.1 64 ITQDEEHLIIKLQKQLGNK-WSKIAKQLP-GRTDNEIKNYWRSHL 106 59*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.055 | 3 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.76E-27 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-12 | 7 | 57 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-13 | 8 | 55 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-20 | 9 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.40E-8 | 10 | 55 | No hit | No description |
PROSITE profile | PS51294 | 26.199 | 56 | 110 | IPR017930 | Myb domain |
SMART | SM00717 | 3.6E-14 | 60 | 108 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.2E-25 | 63 | 109 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.9E-15 | 64 | 106 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 6.94E-10 | 65 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MEEEKLRKGP WLDEEDERLA YVIAILGERR WDALAKASGL RRSGKSCRLR WMNYLRPNLK 60 HGHITQDEEH LIIKLQKQLG NKWSKIAKQL PGRTDNEIKN YWRSHLRKKT LICEQGSIQP 120 SP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-27 | 6 | 110 | 2 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00406 | DAP | Transfer from AT3G53200 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in etiolated seedlings in dark conditions. {ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975448 | 9e-69 | HG975448.1 Solanum pennellii chromosome ch09, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015086827.1 | 6e-85 | transcription factor MYB27-like | ||||
Swissprot | Q9SCP1 | 1e-51 | MYB27_ARATH; Transcription factor MYB27 | ||||
TrEMBL | A0A3Q7HYP8 | 2e-81 | A0A3Q7HYP8_SOLLC; Uncharacterized protein | ||||
STRING | Solyc09g008390.1.1 | 1e-82 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G53200.1 | 6e-54 | myb domain protein 27 |
Publications ? help Back to Top | |||
---|---|---|---|
|