PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen07g026860.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 157aa MW: 18318.8 Da PI: 10.6862 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.9 | 7.3e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd++l +++++G +W+ +++ g+ R++k+c++rw ++l Sopen07g026860.1 14 KGTWTPEEDKKLEAYITKYGCWNWRQLPKYAGLARCGKSCRLRWMNHL 61 799*****************99************************97 PP | |||||||
2 | Myb_DNA-binding | 60.2 | 4.3e-19 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eEdel++++++qlG++ W++Ia +++ gR+++++k++w++ Sopen07g026860.1 67 RGNYTKEEDELILNLHAQLGNR-WSAIAIHLP-GRSDNEIKNHWHT 110 899*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.401 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.64E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.3E-10 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.2E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-23 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.43E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.347 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 1.0E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.5E-17 | 67 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.97E-12 | 69 | 112 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-25 | 69 | 115 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MVRTPSYDEN GRKKGTWTPE EDKKLEAYIT KYGCWNWRQL PKYAGLARCG KSCRLRWMNH 60 LRPNVKRGNY TKEEDELILN LHAQLGNRWS AIAIHLPGRS DNEIKNHWHT SLKKRANYNS 120 SEGSKKCSNK NSGRATTTSW TGKRKPIDYP KPKLRAF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-30 | 14 | 117 | 7 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975446 | 1e-71 | HG975446.1 Solanum pennellii chromosome ch07, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015081535.1 | 1e-95 | transcription factor MYB14-like | ||||
Swissprot | Q7XBH4 | 3e-51 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | A0A3Q7I9M1 | 4e-91 | A0A3Q7I9M1_SOLLC; Uncharacterized protein | ||||
STRING | Solyc07g054980.1.1 | 2e-90 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 4e-53 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|