PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopen06g023350.1

Organism

Solanum pennellii

Taxonomic ID

28526

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MIKC_MADS

Protein Properties

Length: 232aa MW: 26877.8 Da PI: 9.665

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopen06g023350.1	genome	spenn	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	94.6	4.4e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLC+ae+a+i+fs++g++yeys+ Sopen06g023350.1 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCEAEIALIVFSTRGRVYEYSN 59 79***********************************************95 PP
2	K-box	99.4	5.3e-33	79	173	8	100
K-box 8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + ++e +a+ +qqe++kL+++i+++q+++Rhl+Ge+L+ L+++eL+qLe++Le+++++iRskK+e++l+++e+lqk+e l++en Lr+k+ Sopen06g023350.1 79 ActTQELNAQFYQQESKKLRQQIQMMQNSNRHLVGEGLSCLNVRELKQLENRLERGISRIRSKKHEMILAETENLQKREILLEQENAFLRSKI 171 23478899************************************************************************************9 PP K-box 99 ee 100 +e Sopen06g023350.1 172 AE 173 86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	7.2E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.179	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.5E-32	2	76	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.31E-41	2	74	No hit	No description
PRINTS	PR00404	1.8E-31	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.5E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-31	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	7.0E-25	83	171	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.847	87	177	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048481	Biological Process	plant ovule development
GO:0080155	Biological Process	regulation of double fertilization forming a zygote and endosperm
GO:0090376	Biological Process	seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 232 aa Download sequence Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCE AEIALIVFST RGRVYEYSNN 60 NIKATIERYK KATAETSNAC TTQELNAQFY QQESKKLRQQ IQMMQNSNRH LVGEGLSCLN 120 VRELKQLENR LERGISRIRS KKHEMILAET ENLQKREILL EQENAFLRSK IAENERLQEL 180 SMMPAAGGQD YSAIQQYLAR NMLQLNMMEG QGVSSYDPLP PPHHDKKSLE LQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	7e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004241906.1	1e-170	agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_010322781.1	1e-170	agamous-like MADS-box protein AGL11 isoform X2
Refseq	XP_015078663.1	1e-170	agamous-like MADS-box protein AGL11 isoform X1
Refseq	XP_015078664.1	1e-170	agamous-like MADS-box protein AGL11 isoform X2
Refseq	XP_025887358.1	1e-170	agamous-like MADS-box protein AGL11 isoform X1
Swissprot	F6I457	1e-110	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A3Q7GYJ2	1e-169	A0A3Q7GYJ2_SOLLC; Uncharacterized protein
STRING	PGSC0003DMT400013248	1e-168	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.1	2e-98	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]