PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopen05g031840.1

Organism

Solanum pennellii

Taxonomic ID

28526

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 317aa MW: 36738.9 Da PI: 6.9056

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopen05g031840.1	genome	spenn	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.1	8.3e-18	37	84	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT eEd l++ ++ +G g+W++ ar+ g++Rt+k+c++rw++yl Sopen05g031840.1 37 RGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 84 89********************************************97 PP
2	Myb_DNA-binding	51.5	2.4e-16	90	133	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++ Sopen05g031840.1 90 RGNITVEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 133 7999****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	15.459	32	84	IPR017930	Myb domain
SuperFamily	SSF46689	7.49E-31	34	131	IPR009057	Homeodomain-like
SMART	SM00717	5.1E-15	36	86	IPR001005	SANT/Myb domain
Pfam	PF00249	5.0E-16	37	84	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-21	38	91	IPR009057	Homeodomain-like
CDD	cd00167	1.19E-11	39	84	No hit	No description
PROSITE profile	PS51294	23.666	85	139	IPR017930	Myb domain
SMART	SM00717	5.6E-15	89	137	IPR001005	SANT/Myb domain
Pfam	PF00249	4.4E-15	90	133	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.3E-23	92	138	IPR009057	Homeodomain-like
CDD	cd00167	2.16E-11	94	133	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009620	Biological Process	response to fungus
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009737	Biological Process	response to abscisic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 317 aa Download sequence Send to blast
MDYHGQKIEV VGRGREGGRG DSKEEIKEEE IVMDLRRGPW TVEEDFTLIN FIAHHGEGRW 60 NSLARCAGLK RTGKSCRLRW LNYLRPDVRR GNITVEEQLL ILELHSRWGN RWSKIAQHLP 120 GRTDNEIKNY WRTRVQKHAK QLKCDVNSKQ FKDTMKYLWM PRLAERIQAA AATSNPTAAS 180 SSGPTTTYVQ SQEIQHLLPN MNHHVPEYLP IQLMNIEKTN SLNYSATSAS SDNYSSDLTD 240 GCYNFSINQS NNQDHSQVNQ STNQLLYVES TINPTSYNFH PGFQGFQEVD QQNNTQWMEN 300 PWNIEDMCFL QQLNNDM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-24	32	137	2	106	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269\|PubMed:11310740}.
UniProt	Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269\|PubMed:22301384}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00334	DAP	Transfer from AT3G06490	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269\|PubMed:11310740}.
UniProt	INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269\|PubMed:22301384}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975444	0.0	HG975444.1 Solanum pennellii chromosome ch05, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015075113.1	0.0	transcription factor MYB78
Swissprot	Q10MB4	2e-88	MYB2_ORYSJ; Transcription factor MYB2
Swissprot	Q2QZJ8	2e-88	JAMYB_ORYSJ; Transcription factor JAMYB
TrEMBL	A0A3Q7GN67	0.0	A0A3Q7GN67_SOLLC; Uncharacterized protein
STRING	Solyc05g053330.2.1	0.0	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1397	23	75

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49620.1	3e-85	myb domain protein 78

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ahn IP,Kim S,Kang S,Suh SC,Lee YH Rice Defense Mechanisms Against Cochliobolus miyabeanus and Magnaporthe grisea Are Distinct. Phytopathology, 2005. 95(11): p. 1248-55 [PMID:18943354] Campos-Soriano L,García-Martínez J,San Segundo B The arbuscular mycorrhizal symbiosis promotes the systemic induction of regulatory defence-related genes in rice leaves and confers resistance to pathogen infection. Mol. Plant Pathol., 2012. 13(6): p. 579-92 [PMID:22212404] Yang A,Dai X,Zhang WH A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice. J. Exp. Bot., 2012. 63(7): p. 2541-56 [PMID:22301384] Yokotani N, et al. Role of the rice transcription factor JAmyb in abiotic stress response. J. Plant Res., 2013. 126(1): p. 131-9 [PMID:22847900] Chen X, et al. The NAC family transcription factor OsNAP confers abiotic stress response through the ABA pathway. Plant Cell Physiol., 2014. 55(3): p. 604-19 [PMID:24399239] Lv Y, et al. New insights into the genetic basis of natural chilling and cold shock tolerance in rice by genome-wide association analysis. Plant Cell Environ., 2016. 39(3): p. 556-70 [PMID:26381647] Wang D, et al. Expression analysis of innate immunity related genes in the true/field blast resistance gene-mediated defence response. Biotechnol. Biotechnol. Equip., 2014. 28(6): p. 999-1007 [PMID:26740780] Hong Y,Zhang H,Huang L,Li D,Song F Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice. Front Plant Sci, 2016. 7: p. 4 [PMID:26834774] Fred AK,Kiswara G,Yi G,Kim KM Screening Rice Cultivars for Resistance to Bacterial Leaf Blight. J. Microbiol. Biotechnol., 2016. 26(5): p. 938-45 [PMID:26869604]