PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g032030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 328aa    MW: 35832.9 Da    PI: 9.3151
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g032030.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.6e-191459147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEdell  +v+++G+++W++I++ ++ gR++k+c++rw + 
  Sopen04g032030.1 14 KGPWSPEEDELLQTLVEKHGPRNWTLISKSVP-GRSGKSCRLRWCNQ 59
                      79******************************.***********985 PP

2Myb_DNA-binding54.72.3e-1768110347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Sopen04g032030.1  68 AFTPEEDDTIIRAHAKFGNK-WATIARLLS-GRTDNAIKNHWNST 110
                       79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.165964IPR017930Myb domain
SuperFamilySSF466892.58E-3211107IPR009057Homeodomain-like
SMARTSM007177.1E-181362IPR001005SANT/Myb domain
PfamPF002491.8E-191459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-261567IPR009057Homeodomain-like
CDDcd001675.85E-171658No hitNo description
SMARTSM007178.2E-1565113IPR001005SANT/Myb domain
PROSITE profilePS5129421.45966115IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2368114IPR009057Homeodomain-like
CDDcd001674.19E-1268111No hitNo description
PfamPF002497.3E-1568110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MAAITQRKDS DRIKGPWSPE EDELLQTLVE KHGPRNWTLI SKSVPGRSGK SCRLRWCNQL  60
SPQVEHRAFT PEEDDTIIRA HAKFGNKWAT IARLLSGRTD NAIKNHWNST LKRKCPSMSE  120
DLSFETPQPP LKRSSSVGPC TNFSSVMNPG SPSGSDLSDS SLSGFPQPHV YRPVPRTGGI  180
FPLPPPPPVK QIEIPPSVPD PPTSLCLSLP GSGSGSIEKP TQSPKSPPLP PPPLPAVDKP  240
IPPSVPVTCS PSAFMGHLPQ SNQSYDFSAA PKSGEKQFFT PEFLSVLQDM IRKEVKSYMS  300
GFEQNGLCMQ TDAIRNAVIK RIGISKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-40131143104C-Myb DNA-Binding Domain
1msf_C6e-40131143104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015071425.10.0transcription factor MYB44-like
TrEMBLA0A3Q7GA520.0A0A3Q7GA52_SOLLC; Uncharacterized protein
STRINGSolyc04g078420.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-70myb domain protein 73