PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopen03g024780.1

Organism

Solanum pennellii

Taxonomic ID

28526

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB

Protein Properties

Length: 232aa MW: 27152.1 Da PI: 8.4743

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopen03g024780.1	genome	spenn	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.8	3.4e-15	3	50	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd++l+ ++ ++G +W+ ++ g+ Rt+k+c++rw +yl Sopen03g024780.1 3 KGAWSPEEDQKLKSYIMKFGIWNWSHMPKFAGLSRTGKSCRLRWMNYL 50 79****************99**********************97 PP
2	Myb_DNA-binding	45.4	1.9e-14	56	101	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T eE e+ ++ ++lG++ W++Ia++++ gRt++++k++++++l Sopen03g024780.1 56 RGPFTMEEVEIVIKSYQELGNR-WSAIAKRLP-GRTDNEIKNFFHTHL 101 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.323	1	50	IPR017930	Myb domain
SMART	SM00717	1.5E-12	2	52	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	6.36E-29	2	97	IPR009057	Homeodomain-like
Pfam	PF00249	1.1E-13	3	50	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.4E-23	4	57	IPR009057	Homeodomain-like
CDD	cd00167	2.54E-9	5	50	No hit	No description
PROSITE profile	PS51294	22.532	51	105	IPR017930	Myb domain
SMART	SM00717	7.5E-14	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	6.7E-13	56	101	IPR001005	SANT/Myb domain
CDD	cd00167	5.25E-9	58	101	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.1E-25	58	105	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 232 aa Download sequence Send to blast
MKKGAWSPEE DQKLKSYIMK FGIWNWSHMP KFAGLSRTGK SCRLRWMNYL RPDVKRGPFT 60 MEEVEIVIKS YQELGNRWSA IAKRLPGRTD NEIKNFFHTH LKKQLGLKNV GSMKRTKRVV 120 MKKDKDENEM TNIYADKSST NVCNFSSERI NANIITWEEN EMRDIVSSNN IVVDDMEIKE 180 PVILESNPEI EKNSNVGCHL CQFEYPHPCT LSGLDFFHQF DVLWDAQHLA IF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-25	1	105	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269\|PubMed:24415840}.
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.
UniProt	INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:24415840}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975442	0.0	HG975442.1 Solanum pennellii chromosome ch03, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015068505.1	1e-176	transcription factor WER-like
Swissprot	Q9LTC4	1e-45	MYB15_ARATH; Transcription factor MYB15
Swissprot	Q9SJX8	7e-46	MYB14_ARATH; Transcription factor MYB14
TrEMBL	A0A3Q7FLS1	1e-170	A0A3Q7FLS1_SOLLC; Uncharacterized protein
STRING	Solyc03g093930.2.1	1e-171	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G31180.1	3e-48	myb domain protein 14

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen Y, et al. AtMYB14 Regulates Cold Tolerance in Arabidopsis. Plant Mol. Biol. Rep., 2013. 31: p. 87-97 [PMID:24415840] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]