PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen02g015800.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 96aa MW: 10044.6 Da PI: 4.8571 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 74.8 | 2.5e-23 | 1 | 58 | 24 | 81 |
TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 ++a+caa +F+L++eLG+ +d++tieWLl++a+pai+++tgt++ +a+++++ s++ Sopen02g015800.1 1 MPALCAAHVFQLTKELGHRTDGETIEWLLRNAEPAIIAATGTCTLPATQVTTTSENIP 58 9*****************************************9999977633333332 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 3.8E-18 | 1 | 63 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 19.506 | 1 | 39 | IPR017887 | Transcription factor TCP subgroup |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MPALCAAHVF QLTKELGHRT DGETIEWLLR NAEPAIIAAT GTCTLPATQV TTTSENIPLS 60 QSQPSVLAPL TRATPVSGFP AAPLIAEVVI VPAPYV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Can specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269|PubMed:21297037}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 1e-132 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015064776.2 | 5e-51 | transcription factor TCP11-like | ||||
Swissprot | Q9C518 | 7e-22 | TCP8_ARATH; Transcription factor TCP8 | ||||
TrEMBL | A0A3Q7HYI7 | 8e-47 | A0A3Q7HYI7_SOLLC; Uncharacterized protein | ||||
TrEMBL | G3BGV9 | 8e-47 | G3BGV9_SOLLC; TCP transcription factor 19 | ||||
STRING | Solyc09g008030.1.1 | 1e-47 | (Solanum lycopersicum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G58100.1 | 3e-24 | TCP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|