PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sopen02g005800.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 97aa MW: 10758 Da PI: 3.9829 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 78 | 1.2e-24 | 1 | 65 | 30 | 94 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvd 94 +k+ded +mi+ae+Pvll+k+celfi eltlrswl+a+e++++ lkk d+++++ +td dflv Sopen02g005800.1 1 MKTDEDDQMIAAESPVLLAKTCELFIQELTLRSWLNAQEKHQHILKKGDVTDVIIQTDNLDFLVV 65 9**************************************************************84 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.5E-17 | 1 | 64 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.59E-16 | 1 | 64 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.3E-9 | 1 | 51 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MKTDEDDQMI AAESPVLLAK TCELFIQELT LRSWLNAQEK HQHILKKGDV TDVIIQTDNL 60 DFLVVVDDDA IDGSTPSIVP FYIAGGNNGQ DGNNFDH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 3e-18 | 1 | 64 | 27 | 90 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 1e-163 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004231647.1 | 1e-55 | nuclear transcription factor Y subunit C-4-like | ||||
Swissprot | Q9SMP0 | 9e-21 | NFYC1_ARATH; Nuclear transcription factor Y subunit C-1 | ||||
TrEMBL | A0A3Q7FGJ4 | 3e-54 | A0A3Q7FGJ4_SOLLC; Uncharacterized protein | ||||
STRING | Solyc02g021330.1.1 | 5e-55 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12872 | 5 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63470.2 | 3e-21 | nuclear factor Y, subunit C4 |
Publications ? help Back to Top | |||
---|---|---|---|
|