PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g004560.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB
Protein Properties Length: 537aa    MW: 58743.9 Da    PI: 5.0334
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g004560.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-163683148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT  Ed +lvd+v  +G g+W+++ r+ g+ R++k+c++rw ++l
  Sopen01g004560.2 36 KGPWTSAEDVILVDYVMTHGEGNWNAVQRHSGLARCGKSCRLRWANHL 83
                      79******************************************9986 PP

2Myb_DNA-binding537.6e-1789132146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++T+eE++++v++++++G++ W++ a +++ gRt++++k++w++
  Sopen01g004560.2  89 KGAFTPEEEQRIVELHAKMGNK-WARMAVELP-GRTDNEIKNYWNT 132
                       799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9373183IPR017930Myb domain
SuperFamilySSF466898.59E-2933130IPR009057Homeodomain-like
SMARTSM007171.5E-123585IPR001005SANT/Myb domain
PfamPF002494.9E-143683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-233790IPR009057Homeodomain-like
CDDcd001675.82E-103883No hitNo description
PROSITE profilePS5129425.44584138IPR017930Myb domain
SMARTSM007177.7E-1688136IPR001005SANT/Myb domain
PfamPF002493.3E-1589132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2591137IPR009057Homeodomain-like
CDDcd001671.71E-1191132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSIKSETEER MTSKLDMDSP DEASGGDLGE SVPLKKGPWT SAEDVILVDY VMTHGEGNWN  60
AVQRHSGLAR CGKSCRLRWA NHLRPDLKKG AFTPEEEQRI VELHAKMGNK WARMAVELPG  120
RTDNEIKNYW NTRIKRRQRA GLPIYPADIS FMASQNKQNE ELGAFSSADA QNPDVLGINN  180
FEIPAVEFKK LELTHLLYPP QLADIPARSL LNDPVSNFLA QGHRAPYSST YFLSTTYPAK  240
RIRGSESVFS GSNGDLLNSL QYQNDGSLLA QAQAQPLDFS SYNHNLTYDD QRAISNIVPG  300
GHAYLNGNSS SEPTWAMKLE LPSLQNQTEN WGSPHSALPS LDSVDILIQS PPAGHSESGS  360
LSPSNSGLLD AVLHESQTMK ASNDNSYQGN KTSGNAVNNS CPDLKGCDIY GHPVSPLSQF  420
SASVFSDYAP ISESSLHEFP SMATMPGGEI KQEIGDLSPL DDEDNTSNQT IFSSPKTQHA  480
NNHLASKDPF GSCFFDDCDW DCKQIHAVTT SSGQANGHNS CSWDAISAME ATGRMRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29341375107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1754740.0EF175474.1 Solanum lycopersicum GAMyb-like1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015076221.10.0transcription factor GAMYB
RefseqXP_015076298.10.0transcription factor GAMYB
TrEMBLA0A3Q7E9E50.0A0A3Q7E9E5_SOLLC; Uncharacterized protein
STRINGSolyc01g009070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.12e-75myb domain protein 33