PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sp_212490_ssmj.t1

Common Name

SOVF_212490

Organism

Spinacia oleracea

Taxonomic ID

3562

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia

Family

MYB_related

Protein Properties

Length: 128aa MW: 14710.9 Da PI: 6.9301

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sp_212490_ssmj.t1	genome	TBVR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	37	7.9e-12	60	97	4	43
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 WT+ E ++l++av + + Wk++a+ +g gRt+ +++++ Sp_212490_ssmj.t1 60 WTEKETLQLLEAVMHYRDD-WKRVAEQVG-GRTDTSIIHH 97 ***************88.*****.*******9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51293	11.847	55	106	IPR017884	SANT domain
SMART	SM00717	5.2E-6	56	104	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	8.22E-10	56	97	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.2E-8	57	97	IPR009057	Homeodomain-like
CDD	cd00167	2.20E-8	60	97	No hit	No description
Pfam	PF00249	3.1E-11	60	97	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MKPEGDPNVT ISWELHIQCR CPRYLKLLFY GCYVPGNYQV GVTASEFRRV EISEPVKAGW 60 TEKETLQLLE AVMHYRDDWK RVAEQVGGRT DTSIIHHSMI LATQLWLREA TLTLTTELPS 120 MRQALFGG

Functional Description ? help Back to Top
Source	Description
UniProt	Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. May play an essential role in the transition from the vegetative to the reproductive phase of development. May be a positive regulator of ABA signaling. {ECO:0000269\|PubMed:12140326, ECO:0000269\|PubMed:14682613, ECO:0000269\|PubMed:16055636, ECO:0000269\|PubMed:19033529}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021858681.1	2e-88	uncharacterized protein LOC110797862 isoform X5
Swissprot	Q84JG2	2e-21	SWI3B_ARATH; SWI/SNF complex subunit SWI3B
TrEMBL	A0A0K9Q7B2	2e-91	A0A0K9Q7B2_SPIOL; Uncharacterized protein
STRING	POPTR_0002s00620.1	2e-27	(Populus trichocarpa)

Publications ? help Back to Top
Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time. Nucleic Acids Res., 2002. 30(15): p. 3412-21 [PMID:12140326] Zhou C,Miki B,Wu K CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis. Plant Mol. Biol., 2003. 52(6): p. 1125-34 [PMID:14682613] Sarnowski TJ, et al. SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development. Plant Cell, 2005. 17(9): p. 2454-72 [PMID:16055636] Archacki R, et al. Genetic analysis of functional redundancy of BRM ATPase and ATSWI3C subunits of Arabidopsis SWI/SNF chromatin remodelling complexes. Planta, 2009. 229(6): p. 1281-92 [PMID:19301030] Zhu Y,Rowley MJ,Böhmdorfer G,Wierzbicki AT A SWI/SNF chromatin-remodeling complex acts in noncoding RNA-mediated transcriptional silencing. Mol. Cell, 2013. 49(2): p. 298-309 [PMID:23246435] Liu ZW, et al. Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis. PLoS Genet., 2016. 12(5): p. e1006026 [PMID:27171427] Han W, et al. The SWI/SNF subunit SWI3B regulates IAMT1 expression via chromatin remodeling in Arabidopsis leaf development. Plant Sci., 2018. 271: p. 127-132 [PMID:29650150]