PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sp_180450_gwuo.t1 | ||||||||
Common Name | SOVF_180450 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 50aa MW: 5744.56 Da PI: 11.0235 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 52.6 | 1.5e-16 | 17 | 50 | 2 | 36 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrk 36 ep+YVNaKQy++Il+RRq+Rak+e e++ ksrk Sp_180450_gwuo.t1 17 EPIYVNAKQYHGILRRRQSRAKAEMENRA-VKSRK 50 8***************************9.88886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51152 | 20.79 | 15 | 50 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.7E-13 | 17 | 50 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 20 | 40 | IPR018362 | CCAAT-binding factor, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 50 aa Download sequence Send to blast |
MHSSNGVALP AESSKYEPIY VNAKQYHGIL RRRQSRAKAE MENRAVKSRK |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021858672.1 | 1e-27 | nuclear transcription factor Y subunit A-7-like | ||||
TrEMBL | A0A0K9QGZ1 | 1e-27 | A0A0K9QGZ1_SPIOL; Uncharacterized protein (Fragment) | ||||
STRING | XP_010672780.1 | 1e-20 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.1 | 6e-16 | nuclear factor Y, subunit A7 |