PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_169430_giut.t1
Common NameSOVF_169430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Nin-like
Protein Properties Length: 625aa    MW: 71051.8 Da    PI: 5.5732
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_169430_giut.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK32.91.2e-10552591544
             RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44 
                        +s edl  yF++++++AA +Lgv+ ++LKr+C  + I+ W
  Sp_169430_giut.t1 552 VSKEDLLPYFKGTLTEAAHHLGVSKSTLKRKCKDLKIENW 591
                        6889*********************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.353538620IPR003035RWP-RK domain
PfamPF020425.5E-11552591IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.607.8E-4558589IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MLSPELVVEP VPDGIFTSYG SSDPQFHSWV MVDYFPDNNN SGENEDGLGT LSRVDEPTPT  60
NSLPEELVPP FSPVSNFIDQ VNDDGSGIVK LLAEQNLEKT LIEFKPQIKP NQIVAAQLWF  120
PTQIVKKNAL RSSQRNITGT WTETQRFMTD VSEGYLCESL TRVYSCDRKT KTGRSFNFID  180
SLIPYLSATE EVTYLLNRQV SVSAFRLRIP QWAPNLHIYK SAGNRNDIKG PKPSLSQGNY  240
IICGTLAIPV FDPYTNVCVG VYEVVIASTE VDHDVIAIIC NLLKTVNLRA DTQFHYQPRQ  300
RILAEILKII TKVCENHDLP LAQTWMPCTC CDQSSKGQQL CMSNAELPFY MRDSSYYPFW  360
QASTMYHMTE GQAVAGTTFS SKGLCFCRDI TRFPDNFSLV SLSREFKLSC SLAVCLGSSY  420
ANNDVYIVQF FWPNTLKKTL EEDDEMVMSI TMGIKQQFDK LSMVSPTYQE LEAESEQVVY  480
STKHIESDGN GDEFFTLLSN TMTGEEEHSK VSIKQPEEIS FNLLNEETKC IDHGIEVVDR  540
KVSKKSRKKF IVSKEDLLPY FKGTLTEAAH HLGVSKSTLK RKCKDLKIEN WQDERKKKGI  600
GVPARKKRTT KRKLHEEMEF IEEEF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1579597KRKCKDLKIENWQDERKKK
2606613KRTTKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021854358.10.0protein NLP6-like isoform X2
TrEMBLA0A0K9QKC60.0A0A0K9QKC6_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.12e-57Nin-like family protein