PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_166410_xjps.t1
Common NameSOVF_166410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Nin-like
Protein Properties Length: 922aa    MW: 102937 Da    PI: 5.4915
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_166410_xjps.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.1e-29595645252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Sp_166410_xjps.t1 595 EKTVSLSVLQQYFSGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKINKV 645
                        899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.063579665IPR003035RWP-RK domain
PfamPF020425.8E-26597645IPR003035RWP-RK domain
SuperFamilySSF542772.29E-22813904No hitNo description
SMARTSM006667.9E-21822904IPR000270PB1 domain
PROSITE profilePS5174521.963822904IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.1E-24822903No hitNo description
PfamPF005648.7E-17823903IPR000270PB1 domain
CDDcd064071.48E-30823903No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 922 aa     Download sequence    Send to blast
MEYSFAPKEK GNSIWGSSCP QSDIPMAVDS EAMNSTEHHH FVNMSEMMNL DSFGGWCNNL  60
STNEQLLASY AYSSMPSNYT CYDQLSFAEQ SNSTFPMNDS DCSTLNVFGS PLDYVDKIVF  120
AHKDAQLSPP LGSLEDNDCS SKQENMFMLS QNRVPRSLGQ SLPERMLRAL SLFKESSGGG  180
ILAQVWVPIR SGDHHILSTC EQPYLLDKML LGYREVSRSY TFSVEQKPGS FPGLPGRVFI  240
SKLPEWTSNV SYYSSAEYLR VKHALDHEVR GSVALPIFNS DESSCVAVLE LVTVREKSNF  300
DLEMESVCRA LEAVDLKTTT PSRLLPQRLS LNQKTALAEI TDVLRAVCHA HRLPLALTWI  360
PCTFEERDGE QKLRVHVKDN SLDVNEKSIL CIEETACYVN DKEMEGFVHA CAEHFLEEGQ  420
GVAGKALQSN LPFFFPDVKN YHISEYPLVQ HARKFGLSAA VAIRLRSTYT GDDDYILEFF  480
LPLNMKGNKE QQLLLDSLAG TMQRICRSLR TVTDEELISS PDTKVECCDV SKSFLPRDVF  540
LTSSPQLHAQ NGSHGTNQVS CDKPSMRNDN INEDGNSDQA SGSRRPMEKK RSTSEKTVSL  600
SVLQQYFSGS LKDAAKNIGV CPTTLKRICR QHGISRWPSR KINKVNRSLR KIQTVLDSVE  660
GVEGGLKFDP MTGELVASGS VIQEAGARKS LFLPSKSVPS QQCEVGKQNE MCFYENGEIP  720
KVKPENGSDI IESQNEIGIS SNFVQELRKS SGVDYINLVS HPNSCEIERS DGGVSEHHHA  780
TSSGMTDSSN ASGSMCSSPR QSSNDKRRKS EEKMSSEDGR SRITIKVTYK EDTVRFKFEQ  840
STGCLNLYQE VANRFNIQLG NFQLKYLDDE QEWVMLVNDS DLQECLEIME YLGKNSIKFL  900
VRDLTFGMGS SGASNCYLTQ SC
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021845017.10.0protein NLP9-like
SwissprotQ9M1B00.0NLP9_ARATH; Protein NLP9
TrEMBLA0A0K9QLA00.0A0A0K9QLA0_SPIOL; Uncharacterized protein
STRINGXP_010682023.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein