Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 83 | 1.9e-26 | 17 | 67 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr gi+KKAeELSvLCda++a+i+fs gkl+++ss
Sp_162160_ztxp.t2 17 KKIDNITARQVTFSKRRRGIFKKAEELSVLCDADIALIVFSAPGKLFDFSS 67
68***********************************************96 PP
|
2 | K-box | 34.7 | 7.3e-13 | 99 | 179 | 18 | 98 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
+ +l kL e+ + +++R+l GedL+ l+eL +Le+ Le+sl+++ ++K + ++ +ie+lqk+ + l een +L++++
Sp_162160_ztxp.t2 99 NSNLGKLSIEVAEKNKQLRKLRGEDLQGVGLEELLELERMLEDSLTRVLDTKGKRIKHEIETLQKQGDLLMEENLKLKQNM 179
445556666666667999***********************************************************9975 PP
|
Protein Features
? help Back to Top |
|
Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
SMART | SM00432 | 4.2E-37 | 9 | 68 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.931 | 9 | 69 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 11 | 65 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.8E-30 | 11 | 96 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-25 | 11 | 31 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.1E-23 | 18 | 65 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-25 | 31 | 46 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-25 | 46 | 67 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.512 | 95 | 186 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 3.0E-11 | 99 | 178 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0000060 | Biological Process | protein import into nucleus, translocation |
GO:0009739 | Biological Process | response to gibberellin |
GO:0010076 | Biological Process | maintenance of floral meristem identity |
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity |
GO:0010220 | Biological Process | positive regulation of vernalization response |
GO:0010582 | Biological Process | floral meristem determinacy |
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
GO:0048438 | Biological Process | floral whorl development |
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase |
GO:0005634 | Cellular Component | nucleus |
GO:0005737 | Cellular Component | cytoplasm |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0042803 | Molecular Function | protein homodimerization activity |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0046982 | Molecular Function | protein heterodimerization activity |