PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_159010_hoog.t1
Common NameSOVF_159010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family TALE
Protein Properties Length: 432aa    MW: 48564.2 Da    PI: 6.0493
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_159010_hoog.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.3e-093623991954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ +e+  L++++gLt++qV++WF N R +
  Sp_159010_hoog.t1 362 FEHflHPYPNDSEKLTLSSQTGLTKNQVSNWFINARVR 399
                        554458******************************88 PP

2BELL95.25.8e-31225295272
               BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +++lq+k +kL++lle+V+ rY  y++ ++ +issFe+ ag g++k Yt+lAl+a+SrhF +L+dai+ qi
  Sp_159010_hoog.t1 225 KHDLQIKFSKLITLLEQVEGRYDEYCQRMEDLISSFEVLAGEGASKCYTALALQAMSRHFCSLRDAIVTQI 295
                        789******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.2E-21161293IPR006563POX domain
PfamPF075269.5E-33168292IPR006563POX domain
PROSITE profilePS5007111.612340403IPR001356Homeobox domain
SMARTSM003899.5E-9343407IPR001356Homeobox domain
CDDcd000866.46E-11343404No hitNo description
Gene3DG3DSA:1.10.10.602.2E-26348409IPR009057Homeodomain-like
SuperFamilySSF466897.27E-17349411IPR009057Homeodomain-like
PfamPF059201.3E-16360399IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MVSQDTQSNP SPSCSSSLHQ FIVSNPISSQ THFVNPHFDA YGSSNPYPDH NSLGNTHFPT  60
IQSLGERMSR SINLVNQIDP DDHSDVSHTR HFMDLLGAPS EPTHGSNRLS LSLGSQVLHS  120
PQYRQRTFSS ELMQQAYSNL VNSSGDEESC NPGDYSFMGN TSFTAFSVSN SMYLKPAQSI  180
LEQVIDLGSK DIELSDVKRL FMSSRGLCAE LREELMNNSF DSADKHDLQI KFSKLITLLE  240
QVEGRYDEYC QRMEDLISSF EVLAGEGASK CYTALALQAM SRHFCSLRDA IVTQIKVTRK  300
KISPELPKLG SGLSHLSLFD RNSNSRLSLQ QIGLIQGAHR QAWRPIRGLP ENSVIILRAW  360
LFEHFLHPYP NDSEKLTLSS QTGLTKNQVS NWFINARVRL WKPMIEEMYK EEFGDTSVDS  420
SGEGHTEKTE DQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-15349407563Homeobox protein Meis2
4xrm_B1e-15349407563Homeobox protein Meis2
4xrs_A1e-15349406158Homeobox protein Meis1
4xrs_B1e-15349406158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021851054.10.0BEL1-like homeodomain protein 11
RefseqXP_021851055.10.0BEL1-like homeodomain protein 11
SwissprotQ1PFD12e-99BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLA0A0K9QNJ90.0A0A0K9QNJ9_SPIOL; Uncharacterized protein
STRINGXP_010672774.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.11e-101BEL1-like homeodomain 11