PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sp_155320_exug.t1 | ||||||||
Common Name | SOVF_155320 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 151aa MW: 17596.7 Da PI: 7.1827 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.4 | 3.2e-10 | 78 | 113 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+ +gL+++q+ +WF N+R ++ Sp_155320_exug.t1 78 YKWPYPSESEKVALAEATGLDQKQINNWFINQRKRH 113 5679*****************************985 PP | |||||||
2 | ELK | 37.7 | 4.5e-13 | 33 | 54 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsgyL+sLkqE+s Sp_155320_exug.t1 33 ELKNHLLKKYSGYLSSLKQELS 54 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 1.0E-6 | 33 | 54 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 11.243 | 33 | 53 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.2E-10 | 33 | 54 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 13.021 | 53 | 116 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 6.42E-21 | 54 | 129 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 3.4E-13 | 55 | 120 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 2.6E-28 | 58 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.75E-12 | 65 | 117 | No hit | No description |
Pfam | PF05920 | 2.8E-17 | 73 | 112 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 91 | 114 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
DKSEGVGSSE EDQENSGGET ELSEIDPRAE DRELKNHLLK KYSGYLSSLK QELSKKKKKG 60 KLPKEARQKL LSWWELHYKW PYPSESEKVA LAEATGLDQK QINNWFINQR KRHWKPSEDM 120 QFMVMDGIHP HNPALYMDGH YMGDGPYRFG T |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably binds to the DNA sequence 5'-TGAC-3'. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021836777.1 | 1e-108 | homeotic protein knotted-1 isoform X2 | ||||
Swissprot | O04135 | 7e-90 | KNAP2_MALDO; Homeobox protein knotted-1-like 2 | ||||
TrEMBL | A0A0J8BE84 | 1e-106 | A0A0J8BE84_BETVU; Uncharacterized protein | ||||
TrEMBL | A0A0K9QPR3 | 1e-107 | A0A0K9QPR3_SPIOL; Uncharacterized protein (Fragment) | ||||
STRING | XP_010692662.1 | 1e-107 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 5e-74 | KNOTTED-like from Arabidopsis thaliana |