PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sp_149060_opyo.t1 | ||||||||
Common Name | SOVF_149060 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 172aa MW: 19758.9 Da PI: 6.1552 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171.3 | 1.1e-53 | 64 | 159 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf++y++plk yl +yr++ Sp_149060_opyo.t1 64 KEQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALSSLGFDEYADPLKRYLYRYRQF 155 89****************************************************************************************** PP NF-YB 94 egek 97 ege+ Sp_149060_opyo.t1 156 EGER 159 *996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.9E-52 | 58 | 167 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.01E-38 | 66 | 162 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.6E-28 | 69 | 133 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.4E-19 | 97 | 115 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 100 | 116 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.4E-19 | 116 | 134 | No hit | No description |
PRINTS | PR00615 | 5.4E-19 | 135 | 153 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MVDNISPYTN KVLLPNYNLT ATSSSSQQHH HGNYIYHESN TKNSAENEDQ PYNEHEDQAS 60 GTIKEQDRLL PIANVGRIMK NILPPNAKIS KEAKETMQEC VSEFISFVTG EASDKCHKEK 120 RKTVNGDDIC WALSSLGFDE YADPLKRYLY RYRQFEGERI ANQNKDKEIF HG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-44 | 63 | 154 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-44 | 63 | 154 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021856171.1 | 1e-128 | nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 1e-61 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A0K9QRK1 | 1e-127 | A0A0K9QRK1_SPIOL; Uncharacterized protein | ||||
STRING | XP_010684402.1 | 8e-85 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-61 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|