PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_127540_qqae.t1
Common NameSOVF_127540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family Nin-like
Protein Properties Length: 920aa    MW: 101558 Da    PI: 6.5914
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_127540_qqae.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.23.3e-28595645252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        +k+isl+ l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  Sp_127540_qqae.t1 595 QKTISLDILRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIARWPSRKIKKV 645
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291582665IPR003035RWP-RK domain
PfamPF020421.8E-24597645IPR003035RWP-RK domain
SuperFamilySSF542773.92E-22815909No hitNo description
PROSITE profilePS5174522.118824907IPR000270PB1 domain
SMARTSM006669.6E-23824907IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.0E-21825905No hitNo description
CDDcd064075.12E-40825904No hitNo description
PfamPF005643.5E-16826905IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 920 aa     Download sequence    Send to blast
MDNGSFNPAN NPPVFGNIDY DLMEQLLDEG CWLQTADGSN LLQSSTSPGQ GPSPSSSRGL  60
SYPSSFSFPC LEPSLTQAEQ AVDSDCQNNI NSSAITPASV AAAALNQARN FSWEGNELNR  120
ILWIEPKANS GPSTSVGDRL MSAVYQLKEL NRNRDVLIQI WVPIKKGLKS FLTTAEQPYF  180
HQPSSTRLVH YRDVSAKYEF LADEDTKQAL GLPGRVFLGK APEWTPDVRF FRQEEYPRSV  240
YAHKYDVRGS IALPVFEKGS GDSLGVVEII MTTEKFDYRP EVESVCKALE TVHLRSSEIL  300
NIPPEQARKG TDEVVQPEIL TVVRAVCDTL NLPLAQTWAP CSQQGKGGCW HSEKNVHCVS  360
IIDSACYVRD ERVMDFHKAC SDHHLLRSQG GIVGKAFDTN QPCYATDVTE FSKVEYPLSH  420
HAKMFGLRGA VAIRLRGICH ETNDYVLELY LPSDFQENGL SFHTKIWQAV SMVIQQHCQY  480
LHFITDKDFE QKASFQGKTV ADNEIKETSW FSQMMEPQRK GKEVVVSLEF GEDEPSKGFK  540
VMNWSDSEPS LQLGQALSDS ENINQDSASK GISGTSSGSR LPLSARSERR RTKTQKTISL  600
DILRQYFAGS LKDAAKSIGV CPTTLKRICR QHGIARWPSR KIKKVDHSLR KLQLVIDSVQ  660
GAEGSIQLSS FYSKFPELNS PTTQAKPSQV SSINLNNQPK QQLTTQPEGN IYPSGATTSN  720
SPASTSSSQT STSSYCFSSG ANLSSTPVTT IASGSKDAST AEETGGSLKR ARSEAELQGL  780
ITKKEATQIL ERSQSNKTLA EHPSFETLPP FPMTKSWLSR EAGVFKAKAS FGEEKVRFSI  840
LPNTGFQQLQ QEIVKRFSLE DLSKMGIKYL DDDKEWVLLT CDADLEECID IHKSSGSHTI  900
KLSISPLSSL AGSFGSSGLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021867276.10.0protein NLP2-like
TrEMBLA0A0K9QYB00.0A0A0K9QYB0_SPIOL; Uncharacterized protein
STRINGXP_010690230.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein