PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sp_125990_mxyr.t1 | ||||||||
Common Name | SOVF_125990 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 133aa MW: 15594.9 Da PI: 9.8087 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 57.5 | 2.2e-18 | 3 | 55 | 4 | 56 |
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 R ++ + +++Le++Fe++++++ e++ ++A+++gL+ rqV +WFqNrRa+++ Sp_125990_mxyr.t1 3 RSRLCLDKVKALEKHFEEDNKLQPERKLKIAEEVGLEPRQVAIWFQNRRARWR 55 5556667899******************************************9 PP | |||||||
2 | HD-ZIP_I/II | 112.5 | 2.6e-36 | 2 | 93 | 2 | 93 |
HD-ZIP_I/II 2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 k+ rl ++vk+LE++Fee++kL+perK ++a+e+gl+prqva+WFqnrRAR++tkqlE++y L+++ydal ++ +Le+++ +L +lke Sp_125990_mxyr.t1 2 KRSRLCLDKVKALEKHFEEDNKLQPERKLKIAEEVGLEPRQVAIWFQNRRARWRTKQLEREYGDLRASYDALINDYGSLEQQKLDLLVQLKE 93 889***********************************************************************************999987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 17.184 | 1 | 57 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.3E-14 | 1 | 61 | IPR001356 | Homeobox domain |
CDD | cd00086 | 7.63E-13 | 2 | 58 | No hit | No description |
SuperFamily | SSF46689 | 4.71E-17 | 3 | 68 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.5E-19 | 3 | 63 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 1.1E-15 | 3 | 55 | IPR001356 | Homeobox domain |
PRINTS | PR00031 | 3.8E-5 | 28 | 37 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 32 | 55 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 3.8E-5 | 37 | 53 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 4.7E-12 | 57 | 98 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MKRSRLCLDK VKALEKHFEE DNKLQPERKL KIAEEVGLEP RQVAIWFQNR RARWRTKQLE 60 REYGDLRASY DALINDYGSL EQQKLDLLVQ LKELKAKIES RNSEMATNTT NIAMINRSNI 120 VRSENSCMNV GLS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'. {ECO:0000269|PubMed:12678559}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:12678559, ECO:0000269|PubMed:16055682}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021859256.1 | 6e-93 | homeobox-leucine zipper protein ATHB-6-like | ||||
Swissprot | P46667 | 2e-36 | ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5 | ||||
TrEMBL | A0A0K9QYP1 | 2e-92 | A0A0K9QYP1_SPIOL; Uncharacterized protein (Fragment) | ||||
STRING | XP_010675091.1 | 3e-60 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65310.1 | 6e-39 | homeobox protein 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|