PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_085250_rzgq.t1
Common NameSOVF_085250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family TALE
Protein Properties Length: 444aa    MW: 50138.9 Da    PI: 8.2675
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_085250_rzgq.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.85.8e-112713081954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ ++++ LA+k+gL+ +qV++WF N R +
  Sp_085250_rzgq.t1 271 FEHflHPYPTDSDKQMLAEKTGLSRSQVSNWFTNARVR 308
                        665559******************************98 PP

2BELL80.71.9e-261532141172
               BELL  11 kLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         L+s+l+eV+krYk y++q+q  + sFe vaglg+a+p+  +A +a+ rhF+cLk+ai +qi
  Sp_085250_rzgq.t1 153 NLVSMLHEVYKRYKLYCQQMQSAVTSFESVAGLGNAAPFLCFAVRAMFRHFQCLKNAILDQI 214
                        69**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.4E-2490212IPR006563POX domain
PfamPF075261.7E-2696210IPR006563POX domain
PROSITE profilePS5007112.73249312IPR001356Homeobox domain
CDDcd000862.97E-13252313No hitNo description
SMARTSM003892.4E-12252316IPR001356Homeobox domain
SuperFamilySSF466891.45E-17254318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-28255317IPR009057Homeodomain-like
PfamPF059205.4E-18269308IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MDDPFHVPQQ SRRHKLRYHH HHHNHQDDDV IVNPQHHPFL SPLQILQSTS SASTSADHPS  60
LMAAASTNLS LSSSSTHARA YLPSPVGPFT GYASILGRSR FLRPAQDLLE EVSRVSGIPL  120
DKHGRPNNNI LEDSGTLFND TDDDLSLRCS NPNLVSMLHE VYKRYKLYCQ QMQSAVTSFE  180
SVAGLGNAAP FLCFAVRAMF RHFQCLKNAI LDQIRVTSKA FGNVDSRRDS TPGSCSEDKG  240
GPASNFLQHP VWRSQRGFPD KAVAVLRNWL FEHFLHPYPT DSDKQMLAEK TGLSRSQVSN  300
WFTNARVRLW KPMVEEMHAL ERKTQCSKAE DTERIVNLSN DHQTSLHSQL SEKDFQTTYS  360
HREEDNSQCK RSRIEAFARA EQGKEQLRRL CNRLPSNQVL DIGGSHTGQQ HLSHSSAMGS  420
NQDNTTGLSW SNHGQIVPFW LAKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15258316563Homeobox protein Meis2
3k2a_B1e-15258316563Homeobox protein Meis2
4xrm_A1e-15258316563Homeobox protein Meis2
4xrm_B1e-15258316563Homeobox protein Meis2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate. {ECO:0000269|PubMed:12874117, ECO:0000269|PubMed:12897247, ECO:0000269|PubMed:13678595, ECO:0000269|PubMed:15019989, ECO:0000269|PubMed:15120075, ECO:0000269|PubMed:15155890, ECO:0000269|PubMed:16741748}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021845628.10.0BEL1-like homeodomain protein 9
SwissprotQ9LZM82e-69BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0K9RBJ40.0A0A0K9RBJ4_SPIOL; Uncharacterized protein
STRINGXP_010687910.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-71TALE family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  3. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  4. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  5. Bencivenga S,Serrano-Mislata A,Bush M,Fox S,Sablowski R
    Control of Oriented Tissue Growth through Repression of Organ Boundary Genes Promotes Stem Morphogenesis.
    Dev. Cell, 2016. 39(2): p. 198-208
    [PMID:27666746]
  6. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  7. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]